Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetVoltage-gated potassium channel subunit Kv1.5
LigandBDBM50182585
Substrate/Competitorn/a
Meas. Tech.ChEMBL_334900
EC50 900±n/a nM
Citation Harvey, AJBaell, JBToovey, NHomerick, DWulff, H A new class of blockers of the voltage-gated potassium channel Kv1.3 via modification of the 4- or 7-position of khellinone. J Med Chem49:1433-41 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Voltage-gated potassium channel subunit Kv1.5
Name:Voltage-gated potassium channel
Synonyms:HK2 | HPCN1 | Potassium voltage-gated channel subfamily A member 5 | Voltage-gated potassium channel
Type:Enzyme
Mol. Mass.:67222.47
Organism:Homo sapiens (Human)
Description:P22460
Residue:613
Sequence:
MEIALVPLENGGAMTVRGGDEARAGCGQATGGELQCPPTAGLSDGPKEPAPKGRGAQRDA
DSGVRPLPPLPDPGVRPLPPLPEELPRPRRPPPEDEEEEGDPGLGTVEDQALGTASLHHQ
RVHINISGLRFETQLGTLAQFPNTLLGDPAKRLRYFDPLRNEYFFDRNRPSFDGILYYYQ
SGGRLRRPVNVSLDVFADEIRFYQLGDEAMERFREDEGFIKEEEKPLPRNEFQRQVWLIF
EYPESSGSARAIAIVSVLVILISIITFCLETLPEFRDERELLRHPPAPHQPPAPAPGANG
SGVMAPPSGPTVAPLLPRTLADPFFIVETTCVIWFTFELLVRFFACPSKAGFSRNIMNII
DVVAIFPYFITLGTELAEQQPGGGGGGQNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGL
QILGKTLQASMRELGLLIFFLFIGVILFSSAVYFAEADNQGTHFSSIPDAFWWAVVTMTT
VGYGDMRPITVGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETDHEEPAVLKEEQG
TQSQGPGLDRGVQRKVSGSRGSFCKAGGTLENADSARRGSCPLEKCNVKAKSNVDLRRSL
YALCLDTSRETDL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50182585
NameBDBM50182585
Synonyms:5-acetyl-7-(4'-bromo)benzyloxy-6-hydroxy-4-methoxybenzofuran | CHEMBL426482
TypeSmall organic molecule
Emp. Form.C18H15BrO5
Mol. Mass.391.213
SMILESCOc1c(C(C)=O)c(O)c(OCc2ccc(Br)cc2)c2occc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a