Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCalcitonin gene-related peptide type 1 receptor/Receptor activity-modifying protein 1
LigandBDBM50184069
Substrate/Competitorn/a
Meas. Tech.ChEMBL_353838
Ki 0.005±n/a nM
Citation Williams, TMStump, CANguyen, DNQuigley, AGBell, IMGallicchio, SNZartman, CBWan, BLPenna, KDKunapuli, PKane, SAKoblan, KSMosser, SDRutledge, RZSalvatore, CFay, JFVacca, JPGraham, SL Non-peptide calcitonin gene-related peptide receptor antagonists from a benzodiazepinone lead. Bioorg Med Chem Lett16:2595-8 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Calcitonin gene-related peptide type 1 receptor/Receptor activity-modifying protein 1
Name:Calcitonin gene-related peptide type 1 receptor/Receptor activity-modifying protein 1
Synonyms:Calcitonin-gene-related peptide receptor, CALCRL/RAMP1
Type:n/a
Mol. Mass.:n/a
Description:ASSAY_ID of EBI is 327200
Components:This complex has 2 components.
Component 1
Name:Adrenomedullin receptor AM1; CALCRL/RAMP2
Synonyms:Calcitonin gene-related peptide (CGRP) receptor | Calcitonin gene-related peptide 1 (CGRP) | Calcitonin receptor-like receptor
Type:Enzyme
Mol. Mass.:52931.38
Organism:Homo sapiens (Human)
Description:Q16602
Residue:461
Sequence:
MEKKCTLNFLVLLPFFMILVTAELEESPEDSIQLGVTRNKIMTAQYECYQKIMQDPIQQA
EGVYCNRTWDGWLCWNDVAAGTESMQLCPDYFQDFDPSEKVTKICDQDGNWFRHPASNRT
WTNYTQCNVNTHEKVKTALNLFYLTIIGHGLSIASLLISLGIFFYFKSLSCQRITLHKNL
FFSFVCNSVVTIIHLTAVANNQALVATNPVSCKVSQFIHLYLMGCNYFWMLCEGIYLHTL
IVVAVFAEKQHLMWYYFLGWGFPLIPACIHAIARSLYYNDNCWISSDTHLLYIIHGPICA
ALLVNLFFLLNIVRVLITKLKVTHQAESNLYMKAVRATLILVPLLGIEFVLIPWRPEGKI
AEEVYDYIMHILMHFQGLLVSTIFCFFNGEVQAILRRNWNQYKIQFGNSFSNSEALRSAS
YTVSTISDGPGYSHDCPSEHLNGKSIHDIENVLLKPENLYN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:Calcitonin-gene-related peptide receptor, CALCRL/RAMP1
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:16992.80
Organism:Homo sapiens (Human)
Description:EBI_100673
Residue:148
Sequence:
MARALCRLPRRGLWLLLAHHLFMTTACQEANYGALLRELCLTQFQVDMEAVGETLWCDWG
RTIRSYRELADCTWHMAEKLGCFWPNAEVDRFFLAVHGRYFRSCPISGRAVRDPPGSILY
PFIVVPITVTLLVTALVVWQSKRTEGIV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50184069
NameBDBM50184069
Synonyms:CHEMBL207197 | N-((R)-1-((S)-6-amino-1-oxo-1-(4-(pyridin-4-yl)piperazin-1-yl)hexan-2-ylamino)-3-(3,5-dibromo-4-hydroxyphenyl)-1-oxopropan-2-yl)-4-(2-oxo-1,2-dihydroquinazolin-3(4H)-yl)piperidine-1-carboxamide | N-{(1S)-5-amino-1-[(4-pyridin-4-ylpiperazin-1-yl)carbonyl]pentyl}-3,5-dibromo-Nalpha-{[4-(2-oxo-1,4-dihydroquinazolin-3(2H)-yl)piperidin-1-yl]carbonyl}-D-tyrosinamide | OLCEGEPANT
TypeSmall organic molecule
Emp. Form.C38H47Br2N9O5
Mol. Mass.869.645
SMILESNCCCC[C@H](NC(=O)[C@@H](Cc1cc(Br)c(O)c(Br)c1)NC(=O)N1CCC(CC1)N1Cc2ccccc2NC1=O)C(=O)N1CCN(CC1)c1ccncc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a