Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLiver X receptor (LXR alpha AND LXR beta)
LigandBDBM50184261
Substrate/Competitorn/a
Meas. Tech.ChEMBL_364820
IC50 100±n/a nM
Citation Szewczyk, JWHuang, SChin, JTian, JMitnaul, LRosa, RLPeterson, LSparrow, CPAdams, AD SAR studies: designing potent and selective LXR agonists. Bioorg Med Chem Lett16:3055-60 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Liver X receptor (LXR alpha AND LXR beta)
Name:Liver X receptor (LXR alpha AND LXR beta)
Synonyms:Liver X receptor beta (NR1H2) | Liver X, LXR beta | Oxysterols receptor LXR-beta
Type:Protein
Mol. Mass.:50978.79
Organism:Homo sapiens (Human)
Description:P55055
Residue:460
Sequence:
MSSPTTSSLDTPLPGNGPPQPGAPSSSPTVKEEGPEPWPGGPDPDVPGTDEASSACSTDW
VIPDPEEEPERKRKKGPAPKMLGHELCRVCGDKASGFHYNVLSCEGCKGFFRRSVVRGGA
RRYACRGGGTCQMDAFMRRKCQQCRLRKCKEAGMREQCVLSEEQIRKKKIRKQQQESQSQ
SQSPVGPQGSSSSASGPGASPGGSEAGSQGSGEGEGVQLTAAQELMIQQLVAAQLQCNKR
SFSDQPKVTPWPLGADPQSRDARQQRFAHFTELAIISVQEIVDFAKQVPGFLQLGREDQI
ALLKASTIEIMLLETARRYNHETECITFLKDFTYSKDDFHRAGLQVEFINPIFEFSRAMR
RLGLDDAEYALLIAINIFSADRPNVQEPGRVEALQQPYVEALLSYTRIKRPQDQLRFPRM
LMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDVHE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50184261
NameBDBM50184261
Synonyms:2-(4-(3-(7-propyl-3-(trifluoromethyl)benzo[d]isoxazol-6-yloxy)propoxy)phenyl)acetic acid | CHEMBL210973
TypeSmall organic molecule
Emp. Form.C22H22F3NO5
Mol. Mass.437.409
SMILESCCCc1c(OCCCOc2ccc(CC(O)=O)cc2)ccc2c(noc12)C(F)(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a