Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPeroxisome proliferator-activated receptor delta (PPAR delta)
LigandBDBM50184250
Substrate/Competitorn/a
Meas. Tech.ChEMBL_364829
IC50 540±n/a nM
Citation Szewczyk, JWHuang, SChin, JTian, JMitnaul, LRosa, RLPeterson, LSparrow, CPAdams, AD SAR studies: designing potent and selective LXR agonists. Bioorg Med Chem Lett16:3055-60 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Peroxisome proliferator-activated receptor delta (PPAR delta)
Name:Peroxisome proliferator-activated receptor
Synonyms:PPAR delta/gamma | Peroxisome Proliferator-Activated Receptor delta | Peroxisome proliferator-activated receptor
Type:Enzyme
Mol. Mass.:49910.45
Organism:Homo sapiens (Human)
Description:Q03181
Residue:441
Sequence:
MEQPQEEAPEVREEEEKEEVAEAEGAPELNGGPQHALPSSSYTDLSRSSSPPSLLDQLQM
GCDGASCGSLNMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCERSCKIQKK
NRNKCQYCRFQKCLALGMSHNAIRFGRMPEAEKRKLVAGLTANEGSQYNPQVADLKAFSK
HIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKE
ISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNK
DGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGD
RPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRI
KKTETETSLHPLLQEIYKDMY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50184250
NameBDBM50184250
Synonyms:2-(4-(methyl(3-(7-propyl-3-(trifluoromethyl)benzo[d]isoxazol-6-yloxy)propyl)amino)-2-(trifluoromethyl)phenyl)acetic acid | CHEMBL382789
TypeSmall organic molecule
Emp. Form.C24H24F6N2O4
Mol. Mass.518.4488
SMILESCCCc1c(OCCCN(C)c2ccc(CC(O)=O)c(c2)C(F)(F)F)ccc2c(noc12)C(F)(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a