Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLiver X receptor (LXR alpha AND LXR beta)
LigandBDBM50184265
Substrate/Competitorn/a
Meas. Tech.ChEMBL_364822
IC50 6400±n/a nM
Citation Szewczyk, JWHuang, SChin, JTian, JMitnaul, LRosa, RLPeterson, LSparrow, CPAdams, AD SAR studies: designing potent and selective LXR agonists. Bioorg Med Chem Lett16:3055-60 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Liver X receptor (LXR alpha AND LXR beta)
Name:Liver X receptor (LXR alpha AND LXR beta)
Synonyms:Liver X Receptor alpha (LXR-alpha) | Liver X receptor alpha | Liver X receptor alpha (LXRA) | Liver X receptor alpha (NR1H3) | Liver X, LXR alpha | Nuclear orphan receptor LXR-alpha | Nuclear receptor subfamily 1 group H member 3 | Oxysterols receptor LXR-alpha
Type:Receptor
Mol. Mass.:50403.85
Organism:Homo sapiens (human)
Description:His-tagged hLXR.
Residue:447
Sequence:
MSLWLGAPVPDIPPDSAVELWKPGAQDASSQAQGGSSCILREEARMPHSAGGTAGVGLEA
AEPTALLTRAEPPSEPTEIRPQKRKKGPAPKMLGNELCSVCGDKASGFHYNVLSCEGCKG
FFRRSVIKGAHYICHSGGHCPMDTYMRRKCQECRLRKCRQAGMREECVLSEEQIRLKKLK
RQEEEQAHATSLPPRASSPPQILPQLSPEQLGMIEKLVAAQQQCNRRSFSDRLRVTPWPM
APDPHSREARQQRFAHFTELAIVSVQEIVDFAKQLPGFLQLSREDQIALLKTSAIEVMLL
ETSRRYNPGSESITFLKDFSYNREDFAKAGLQVEFINPIFEFSRAMNELQLNDAEFALLI
AISIFSADRPNVQDQLQVERLQHTYVEALHAYVSIHHPHDRLMFPRMLMKLVSLRTLSSV
HSEQVFALRLQDKKLPPLLSEIWDVHE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50184265
NameBDBM50184265
Synonyms:2-(4-(N-(3-(7-propyl-3-(trifluoromethyl)benzo[d]isoxazol-6-yloxy)propyl)acetamido)phenyl)acetic acid | CHEMBL207093
TypeSmall organic molecule
Emp. Form.C24H25F3N2O5
Mol. Mass.478.4609
SMILESCCCc1c(OCCCN(C(C)=O)c2ccc(CC(O)=O)cc2)ccc2c(noc12)C(F)(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a