Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetInterleukin-1 receptor-associated kinase 1
LigandBDBM50184706
Substrate/Competitorn/a
Meas. Tech.ChEMBL_356041
IC50 300±n/a nM
Citation Powers, JPLi, SJaen, JCLiu, JWalker, NPWang, ZWesche, H Discovery and initial SAR of inhibitors of interleukin-1 receptor-associated kinase-4. Bioorg Med Chem Lett16:2842-5 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Interleukin-1 receptor-associated kinase 1
Name:Interleukin-1 receptor-associated kinase 1
Synonyms:IRAK | IRAK-1 | IRAK1 | Interleukin-1 receptor-associated kinase 1 (IRAK-1)
Type:Enzyme
Mol. Mass.:76536.81
Organism:Homo sapiens (Human)
Description:P51617
Residue:712
Sequence:
MAGGPGPGEPAAPGAQHFLYEVPPWVMCRFYKVMDALEPADWCQFAALIVRDQTELRLCE
RSGQRTASVLWPWINRNARVADLVHILTHLQLLRARDIITAWHPPAPLPSPGTTAPRPSS
IPAPAEAEAWSPRKLPSSASTFLSPAFPGSQTHSGPELGLVPSPASLWPPPPSPAPSSTK
PGPESSVSLLQGARPFPFCWPLCEISRGTHNFSEELKIGEGGFGCVYRAVMRNTVYAVKR
LKENADLEWTAVKQSFLTEVEQLSRFRHPNIVDFAGYCAQNGFYCLVYGFLPNGSLEDRL
HCQTQACPPLSWPQRLDILLGTARAIQFLHQDSPSLIHGDIKSSNVLLDERLTPKLGDFG
LARFSRFAGSSPSQSSMVARTQTVRGTLAYLPEEYIKTGRLAVDTDTFSFGVVVLETLAG
QRAVKTHGARTKYLKDLVEEEAEEAGVALRSTQSTLQAGLAADAWAAPIAMQIYKKHLDP
RPGPCPPELGLGLGQLACCCLHRRAKRRPPMTQVYERLEKLQAVVAGVPGHSEAASCIPP
SPQENSYVSSTGRAHSGAAPWQPLAAPSGASAQAAEQLQRGPNQPVESDESLGGLSAALR
SWHLTPSCPLDPAPLREAGCPQGDTAGESSWGSGPGSRPTAVEGLALGSSASSSSEPPQI
IINPARQKMVQKLALYEDGALDSLQLLSSSSLPGLGLEQDRQGPEESDEFQS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50184706
NameBDBM50184706
Synonyms:CHEMBL379787 | N-(1-(2-morpholinoethyl)-1H-benzo[d]imidazol-2-yl)-3-nitrobenzamide
TypeSmall organic molecule
Emp. Form.C20H21N5O4
Mol. Mass.395.4118
SMILES[O-][N+](=O)c1cccc(c1)C(=O)Nc1nc2ccccc2n1CCN1CCOCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a