Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetcPLA2 C2
LigandBDBM50185349
Substrate/Competitorn/a
Meas. Tech.ChEMBL_341906
IC50 16±n/a nM
Citation Ludwig, JBovens, SBrauch, CElfringhoff, ASLehr, M Design and synthesis of 1-indol-1-yl-propan-2-ones as inhibitors of human cytosolic phospholipase A2alpha. J Med Chem49:2611-20 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
cPLA2 C2
Name:Cytosolic phospholipase A2
Synonyms:Cytosolic phospholipase A2 | Lysophospholipase | Phosphatidylcholine 2-acylhydrolase | Phospholipase A2 | Phospholipase A2 group IVA | cPLA2
Type:Protein
Mol. Mass.:85219.30
Organism:Homo sapiens (Human)
Description:P47712
Residue:749
Sequence:
MSFIDPYQHIIVEHQYSHKFTVVVLRATKVTKGAFGDMLDTPDPYVELFISTTPDSRKRT
RHFNNDINPVWNETFEFILDPNQENVLEITLMDANYVMDETLGTATFTVSSMKVGEKKEV
PFIFNQVTEMVLEMSLEVCSCPDLRFSMALCDQEKTFRQQRKEHIRESMKKLLGPKNSEG
LHSARDVPVVAILGSGGGFRAMVGFSGVMKALYESGILDCATYVAGLSGSTWYMSTLYSH
PDFPEKGPEEINEELMKNVSHNPLLLLTPQKVKRYVESLWKKKSSGQPVTFTDIFGMLIG
ETLIHNRMNTTLSSLKEKVNTAQCPLPLFTCLHVKPDVSELMFADWVEFSPYEIGMAKYG
TFMAPDLFGSKFFMGTVVKKYEENPLHFLMGVWGSAFSILFNRVLGVSGSQSRGSTMEEE
LENITTKHIVSNDSSDSDDESHEPKGTENEDAGSDYQSDNQASWIHRMIMALVSDSALFN
TREGRAGKVHNFMLGLNLNTSYPLSPLSDFATQDSFDDDELDAAVADPDEFERIYEPLDV
KSKKIHVVDSGLTFNLPYPLILRPQRGVDLIISFDFSARPSDSSPPFKELLLAEKWAKMN
KLPFPKIDPYVFDREGLKECYVFKPKNPDMEKDCPTIIHFVLANINFRKYRAPGVPRETE
EEKEIADFDIFDDPESPFSTFNFQYPNQAFKRLHDLMHFNTLNNIDVIKEAMVESIEYRR
QNPSRCSVSLSNVEARRFFNKEFLSKPKA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50185349
NameBDBM50185349
Synonyms:3-formyl-1-(3-(4-octylphenoxy)-2-oxopropyl)-1H-indole-5-carboxylic acid | 3-formyl-1-[3-(4-octylphenoxy)-2-oxopropyl]indole-5-carboxylic acid | CHEMBL204618
TypeSmall organic molecule
Emp. Form.C27H31NO5
Mol. Mass.449.5387
SMILESCCCCCCCCc1ccc(OCC(=O)Cn2cc(C=O)c3cc(ccc23)C(O)=O)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a