Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBeta-glucosidase
LigandBDBM50186736
Substrate/Competitorn/a
Meas. Tech.ChEMBL_353428
pH6.8±n/a
Ki>1000000±n/a nM
Commentsextracted
Citation Wang, RWQiu, XLBols, MOrtega-Caballero, FQing, FL Synthesis and biological evaluation of glycosidase inhibitors: gem-difluoromethylenated nojirimycin analogues. J Med Chem49:2989-97 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Beta-glucosidase
Name:Beta-glucosidase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:89534.43
Organism:Hansenula anomala
Description:ChEMBL_353428
Residue:825
Sequence:
MLLPLYGLASFLVLSQAALVNTSAPQASNDDPFNHSPSFYPTPQGGRINDGKWQAAFYRA
RELVDQMSIAEKVNLTTGVGSASGPCSGNTGSVPRLNISSICVQDGPLSVRAADLTDVFP
CGMAASSSFNKQLIYDRAVAIGSEFKGKGADAILGPVYGPMGVKAAGGRGWEGHGPDPYL
EGVIAYLQTIGIQSQGVVSTAKHLIGNEQEHFRFAKKDKHAGKIDPGMFNTSSSLSSEID
DRAMHEIYLWPFAEAVRGGVSSIMCSYNKLNGSHACQNSYLLNYLLKEELGFQGFVMTDW
GALYSGIDAANAGLDMDMPCEAQYFGGNLTTAVLNGTLPQDRLDDMATRILSALIYSGVH
NPDGPNYNAQTFLTEGHEYFKQQEGDIVVLNKHVDVRSDINRAVALRSAVEGVVLLKNEH
ETLPLGREKVKRISILGQAAGDDSKGTSCSLRGCGSGAIGTGYGSGAGTFSYFVTPADGI
GARAQQEKISYEFIGDSWNQAAAMDSALYADAAIEVANSVAGEEIGDVDGNYGDLNNLTL
WHNAVPLIKNISSINNNTIVIVTSGQQIDLEPFIDNENVTAVIYSSYLGQDFGTVLAKVL
FGDENPSGKLPFTIAKDVNDYIPVIEKVDVPDPVDKFTESIYVDYRYFDKYNKPVRYEFG
YGLSYSNFSLSDIEIQTLQPFSENAEPAANYSETYQYKQSNMDPSEYTVPEGFKELANYT
YPYIHDASSIKANSSYDYPEGYSTEQLDGPKSLAAGGLGGNHTCGMLVTLSLLKSQIKVL
MLVGLHLNCMLDIQIMMNSQHLQCNYVDLKRCFWIKIILKLFLLN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50186736
NameBDBM50186736
Synonyms:CHEMBL380311 | L-1,4-dideoxy-4,4-difluorogulonojirimycin
TypeSmall organic molecule
Emp. Form.C6H11F2NO3
Mol. Mass.183.1532
SMILESOC[C@@H]1NC[C@@H](O)[C@@H](O)C1(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a