Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha-mannosidase
LigandBDBM50186732
Substrate/Competitorn/a
Meas. Tech.ChEMBL_353423
pH6.8±n/a
Ki>1000000±n/a nM
Commentsextracted
Citation Wang, RWQiu, XLBols, MOrtega-Caballero, FQing, FL Synthesis and biological evaluation of glycosidase inhibitors: gem-difluoromethylenated nojirimycin analogues. J Med Chem49:2989-97 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Alpha-mannosidase
Name:Alpha-mannosidase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:65344.50
Organism:Glycine max
Description:ChEMBL_32380
Residue:578
Sequence:
MARGSRSVGSSSSKWRYCNPSYYLKRPKRLALLFIVFVCVSFVFWDRQTLVREHQVEISE
LQKEVTDLKNLVDDLNNKQGGTSGKTDLGRKATKSSKDVLDDPIDIERREKVKEAMLHAW
GSYEKYAWGQDELQPQSKNGVNSFGGLGATLIDSLDTLYIMGLNEQFQKAREWVANSLDF
NKDYEASVFETTIRVVGGLLSAYDLSGDKVFLDKAIEIADRLLPAWNTPTGIPYNIINLS
HGRAHNPSWTGGESILADSGTEQLEFIVLSQRTGDLKYQQKVENVIAQLNKTFPDDGLLP
IYINPHSGAAGYSPITFGAMGDSFYEYLLKVWIQGNKTSSIKHYRDMWEKSMKGLSSLIR
RSTPSSFTYICEKNGGSLTDKMDELACFAPGMIALGSFGYSAADDSQKFLSLAEELAWTC
YNFYQSTPTKLAGENYFFHSGQDMSVGTSWNILRPETVESLFYLWRLTGNKTYQEWGWNI
FQAFEKNSRIESGYVGLKDVNSGVKDNMMQSFFLAETLKYFYLLFSPSSVISLDEWVFNT
EAHPLRIVTRHEEGLVKNLNEKQKPFSRIGGRKEGRSG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50186732
NameBDBM50186732
Synonyms:CHEMBL206628 | D-1,4,6-trideoxy-4,4-difluoronojirimycin
TypeSmall organic molecule
Emp. Form.C6H11F2NO2
Mol. Mass.167.1538
SMILESC[C@H]1NC[C@H](O)[C@@H](O)C1(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a