Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMelanocortin receptor 3 (MC3R)
LigandBDBM50189010
Substrate/Competitorn/a
Meas. Tech.ChEMBL_395994
Ki 1±n/a nM
Citation Tian, XMishra, RKSwitzer, AGHu, XEKim, NMazur, AWEbetino, FHWos, JACrossdoersen, DPinney, BBFarmer, JASheldon, RJ Design and synthesis of potent and selective 1,3,4-trisubstituted-2-oxopiperazine based melanocortin-4 receptor agonists. Bioorg Med Chem Lett16:4668-73 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Melanocortin receptor 3 (MC3R)
Name:Melanocortin receptor (M3 and M4)
Synonyms:MC3-R | MC3R | Melanocortin MC3 | Melanocortin receptor (M3 and M4) | Melanocortin receptor 3
Type:Enzyme
Mol. Mass.:36044.86
Organism:Homo sapiens (Human)
Description:P41968
Residue:323
Sequence:
MNASCCLPSVQPTLPNGSEHLQAPFFSNQSSSAFCEQVFIKPEVFLSLGIVSLLENILVI
LAVVRNGNLHSPMYFFLCSLAVADMLVSVSNALETIMIAIVHSDYLTFEDQFIQHMDNIF
DSMICISLVASICNLLAIAVDRYVTIFYALRYHSIMTVRKALTLIVAIWVCCGVCGVVFI
VYSESKMVIVCLITMFFAMMLLMGTLYVHMFLFARLHVKRIAALPPADGVAPQQHSCMKG
AVTITILLGVFIFCWAPFFLHLVLIITCPTNPYCICYTAHFNTYLVLIMCNSVIDPLIYA
FRSLELRNTFREILCGCNGMNLG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50189010
NameBDBM50189010
Synonyms:(S)-2-[(S)-4-{(R)-2-[(S)-2-acetylamino-3-(4-hydroxy-phenyl)-propionylamino]-3-phenyl-propionyl}-3-(3-guanidino-propyl)-2-oxo-piperazin-1-yl]-N-methyl-3-naphthalen-2-yl-propionamide | CHEMBL379054
TypeSmall organic molecule
Emp. Form.C42H50N8O6
Mol. Mass.762.8964
SMILES[#6]-[#7]-[#6](=O)-[#6@H](-[#6]-c1ccc2ccccc2c1)-[#7]-1-[#6]-[#6]-[#7](-[#6@@H](-[#6]-[#6]-[#6]\[#7]=[#6](\[#7])-[#7])-[#6]-1=O)-[#6](=O)-[#6@@H](-[#6]-c1ccccc1)-[#7]-[#6](=O)-[#6@H](-[#6]-c1ccc(-[#8])cc1)-[#7]-[#6](-[#6])=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a