Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSodium/hydrogen exchanger 1
LigandBDBM50191842
Substrate/Competitorn/a
Meas. Tech.ChEMBL_397780
IC50 61±n/a nM
Citation Atwal, KSO'Neil, SVAhmad, SDoweyko, LKirby, MDorso, CRChandrasena, GChen, BCZhao, RZahler, R Synthesis and biological activity of 5-aryl-4-(4-(5-methyl-1H-imidazol-4-yl)piperidin-1-yl)pyrimidine analogs as potent, highly selective, and orally bioavailable NHE-1 inhibitors. Bioorg Med Chem Lett16:4796-9 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Sodium/hydrogen exchanger 1
Name:Sodium/hydrogen exchanger 1
Synonyms:APNH | NHE-1 | Na(+)/H(+) antiporter, amiloride-sensitive | Na(+)/H(+) exchanger 1 | Solute carrier family 9 member 1
Type:PROTEIN
Mol. Mass.:90771.96
Organism:Homo sapiens
Description:ChEMBL_862405
Residue:815
Sequence:
MVLRSGICGLSPHRIFPSLLVVVALVGLLPVLRSHGLQLSPTASTIRSSEPPRERSIGDV
TTAPPEVTPESRPVNHSVTDHGMKPRKAFPVLGIDYTHVRTPFEISLWILLACLMKIGFH
VIPTISSIVPESCLLIVVGLLVGGLIKGVGETPPFLQSDVFFLFLLPPIILDAGYFLPLR
QFTENLGTILIFAVVGTLWNAFFLGGLMYAVCLVGGEQINNIGLLDNLLFGSIISAVDPV
AVLAVFEEIHINELLHILVFGESLLNDAVTVVLYHLFEEFANYEHVGIVDIFLGFLSFFV
VALGGVLVGVVYGVIAAFTSRFTSHIRVIEPLFVFLYSYMAYLSAELFHLSGIMALIASG
VVMRPYVEANISHKSHTTIKYFLKMWSSVSETLIFIFLGVSTVAGSHHWNWTFVISTLLF
CLIARVLGVLGLTWFINKFRIVKLTPKDQFIIAYGGLRGAIAFSLGYLLDKKHFPMCDLF
LTAIITVIFFTVFVQGMTIRPLVDLLAVKKKQETKRSINEEIHTQFLDHLLTGIEDICGH
YGHHHWKDKLNRFNKKYVKKCLIAGERSKEPQLIAFYHKMEMKQAIELVESGGMGKIPSA
VSTVSMQNIHPKSLPSERILPALSKDKEEEIRKILRNNLQKTRQRLRSYNRHTLVADPYE
EAWNQMLLRRQKARQLEQKINNYLTVPAHKLDSPTMSRARIGSDPLAYEPKEDLPVITID
PASPQSPESVDLVNEELKGKVLGLSRDPAKVAEEDEDDDGGIMMRSKETSSPGTDDVFTP
APSDSPSSQRIQRCLSDPGPHPEPGEGEPFFPKGQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50191842
NameBDBM50191842
Synonyms:5-(3-chlorophenyl)-4-(4-(4-methyl-1H-imidazol-5-yl)piperidin-1-yl)pyrimidine | CHEMBL384466
TypeSmall organic molecule
Emp. Form.C19H20ClN5
Mol. Mass.353.849
SMILESCc1nc[nH]c1C1CCN(CC1)c1ncncc1-c1cccc(Cl)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a