Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLysophosphatidic acid receptor 3 (LPAR3)
LigandBDBM50193517
Substrate/Competitorn/a
Meas. Tech.ChEMBL_385203
Ki 636±n/a nM
Citation Xu, YJiang, GTsukahara, RFujiwara, YTigyi, GPrestwich, GD Phosphonothioate and fluoromethylene phosphonate analogues of cyclic phosphatidic acid: Novel antagonists of lysophosphatidic acid receptors. J Med Chem49:5309-15 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Lysophosphatidic acid receptor 3 (LPAR3)
Name:Lysophosphatidic acid receptor 1/3
Synonyms:Lysophosphatidic acid receptor Edg-7
Type:Enzyme
Mol. Mass.:40149.72
Organism:Homo sapiens (Human)
Description:Q9UBY5
Residue:353
Sequence:
MNECHYDKHMDFFYNRSNTDTVDDWTGTKLVIVLCVGTFFCLFIFFSNSLVIAAVIKNRK
FHFPFYYLLANLAAADFFAGIAYVFLMFNTGPVSKTLTVNRWFLRQGLLDSSLTASLTNL
LVIAVERHMSIMRMRVHSNLTKKRVTLLILLVWAIAIFMGAVPTLGWNCLCNISACSSLA
PIYSRSYLVFWTVSNLMAFLIMVVVYLRIYVYVKRKTNVLSPHTSGSISRRRTPMKLMKT
VMTVLGAFVVCWTPGLVVLLLDGLNCRQCGVQHVKRWFLLLALLNSVVNPIIYSYKDEDM
YGTMKKMICCFSQENPERRPSRIPSTVLSRSDTGSQYIEDSISQGAVCNKSTS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50193517
NameBDBM50193517
Synonyms:3-hydroxyl-4-oleoyloxylbutane 1,3-cyclic phosphonothioate | CHEMBL212029
TypeSmall organic molecule
Emp. Form.C22H43O4PS
Mol. Mass.434.613
SMILESCCCCCCCCCCCCCCCCCC(=O)OCC1CCP(O)(=S)O1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a