Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target11-beta-hydroxysteroid dehydrogenase 2
LigandBDBM50193790
Substrate/Competitorn/a
Meas. Tech.ChEMBL_424102
IC50 20±n/a nM
Citation Yeh, VSKurukulasuriya, RFung, SMonzon, KChiou, WWang, JStolarik, DImade, HShapiro, RKnourek-Segel, VBush, EWilcox, DNguyen, PTBrune, MJacobson, PLink, JT Discovery of orally active butyrolactam 11beta-HSD1 inhibitors. Bioorg Med Chem Lett16:5555-60 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
11-beta-hydroxysteroid dehydrogenase 2
Name:11-beta-hydroxysteroid dehydrogenase 2
Synonyms:11-DH2 | 11-beta-HSD2 | 11-beta-Hydroxysteroid Dehydrogenase 2 (11-beta-HSD2) | 11-beta-hydroxysteroid dehydrogenase type 2 | 11-beta-hydroxysteroid dehydrogenase type 2 (11-beta-HSD2) | Corticosteroid 11-beta-dehydrogenase isozyme 2 | NAD-dependent 11-beta-hydroxysteroid dehydrogenase
Type:Enzyme
Mol. Mass.:44141.72
Organism:Homo sapiens (Human)
Description:Purified recombinant human 11beta-HSD2.
Residue:405
Sequence:
MERWPWPSGGAWLLVAARALLQLLRSDLRLGRPLLAALALLAALDWLCQRLLPPPAALAV
LAAAGWIALSRLARPQRLPVATRAVLITGCDSGFGKETAKKLDSMGFTVLATVLELNSPG
AIELRTCCSPRLRLLQMDLTKPGDISRVLEFTKAHTTSTGLWGLVNNAGHNEVVADAELS
PVATFRSCMEVNFFGALELTKGLLPLLRSSRGRIVTVGSPAGDMPYPCLGAYGTSKAAVA
LLMDTFSCELLPWGVKVSIIQPGCFKTESVRNVGQWEKRKQLLLANLPQELLQAYGKDYI
EHLHGQFLHSLRLAMSDLTPVVDAITDALLAARPRRRYYPGQGLGLMYFIHYYLPEGLRR
RFLQAFFISHCLPRALQPGQPGTTPPQDAAQDPNLSPGPSPAVAR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50193790
NameBDBM50193790
Synonyms:6-((1-cycloheptyl-4,4-dimethyl-5-oxopyrrolidin-3-yl)methoxy)nicotinonitrile | CHEMBL384650
TypeSmall organic molecule
Emp. Form.C20H27N3O2
Mol. Mass.341.4473
SMILESCC1(C)C(COc2ccc(cn2)C#N)CN(C2CCCCCC2)C1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a