Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFibroblast activation protein alpha
LigandBDBM50050513
Substrate/Competitorn/a
Meas. Tech.ChEMBL_453125
IC50 24±n/a nM
Citation Danilova, OLi, BSzardenings, AKHuber, BTRosenblum, JS Synthesis and activity of a potent, specific azabicyclo[3.3.0]-octane-based DPP II inhibitor. Bioorg Med Chem Lett17:507-10 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Fibroblast activation protein alpha
Name:Fibroblast activation protein alpha
Synonyms:170 kDa melanoma membrane-bound gelatinase | Integral membrane serine protease | Seprase
Type:Enzyme
Mol. Mass.:87712.48
Organism:Homo sapiens (Human)
Description:Q12884
Residue:760
Sequence:
MKTWVKIVFGVATSAVLALLVMCIVLRPSRVHNSEENTMRALTLKDILNGTFSYKTFFPN
WISGQEYLHQSADNNIVLYNIETGQSYTILSNRTMKSVNASNYGLSPDRQFVYLESDYSK
LWRYSYTATYYIYDLSNGEFVRGNELPRPIQYLCWSPVGSKLAYVYQNNIYLKQRPGDPP
FQITFNGRENKIFNGIPDWVYEEEMLATKYALWWSPNGKFLAYAEFNDTDIPVIAYSYYG
DEQYPRTINIPYPKAGAKNPVVRIFIIDTTYPAYVGPQEVPVPAMIASSDYYFSWLTWVT
DERVCLQWLKRVQNVSVLSICDFREDWQTWDCPKTQEHIEESRTGWAGGFFVSTPVFSYD
AISYYKIFSDKDGYKHIHYIKDTVENAIQITSGKWEAINIFRVTQDSLFYSSNEFEEYPG
RRNIYRISIGSYPPSKKCVTCHLRKERCQYYTASFSDYAKYYALVCYGPGIPISTLHDGR
TDQEIKILEENKELENALKNIQLPKEEIKKLEVDEITLWYKMILPPQFDRSKKYPLLIQV
YGGPCSQSVRSVFAVNWISYLASKEGMVIALVDGRGTAFQGDKLLYAVYRKLGVYEVEDQ
ITAVRKFIEMGFIDEKRIAIWGWSYGGYVSSLALASGTGLFKCGIAVAPVSSWEYYASVY
TERFMGLPTKDDNLEHYKNSTVMARAEYFRNVDYLLIHGTADDNVHFQNSAQIAKALVNA
QVDFQAMWYSDQNHGLSGLSTNHLYTHMTHFLKQCFSLSD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50050513
NameBDBM50050513
Synonyms:(R)-1-((S)-2-amino-3-methylbutanoyl)pyrrolidin-2-ylboronic acid | (S)-2-Amino-1-((R)-2-dihydroxyboron-pyrrolidin-1-yl)-3-methyl-butan-1-one | (S)-2-Amino-3-methyl-2-boronic acid-1-pyrrolidin-1-yl-butan-1-one | Boronic acid derivative | CHEMBL67279 | Ketopyrrolidine derivative | Pyrrolidine derivative
TypeSmall organic molecule
Emp. Form.C9H19BN2O3
Mol. Mass.214.07
SMILESCC(C)[C@H](N)C(=O)N1CCC[C@H]1B(O)O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a