Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMelanin-concentrating hormone receptor
LigandBDBM50199210
Substrate/Competitorn/a
Meas. Tech.ChEMBL_411945
IC50 3980±n/a nM
Citation Tavares, FXAl-Barazanji, KABigham, ECBishop, MJBritt, CSCarlton, DLFeldman, PLGoetz, ASGrizzle, MKGuo, YCHandlon, ALHertzog, DLIgnar, DMLang, DGOtt, RJPeat, AJZhou, HQ Potent, selective, and orally efficacious antagonists of melanin-concentrating hormone receptor 1. J Med Chem49:7095-107 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Melanin-concentrating hormone receptor
Name:Melanin-concentrating hormone receptor
Synonyms:G-protein coupled receptor 24 | GPR24 | MCH receptor 1 | MCH-1R | MCH-R1 | MCHR | MCHR-1 | Melanin Concentrating Hormone 1 | Melanin-Concentrating Hormone Receptor 1 (MCH1R) | Melanin-concentrating hormone receptor 1 (MCH-1) | Melanin-concentrating hormone receptor 1 (MCH1) | Melanin-concentrating hormone receptor 1 (MCHR-1) | Melanin-concentrating hormone receptor 1 (MCHR1) | SLC-1 | Somatostatin receptor-like protein
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:45976.27
Organism:Homo sapiens (human)
Description:Membranes from CHO-K1 cells stably expressing human MCH1R were used in assays.
Residue:422
Sequence:
MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARL
WEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTIC
LLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHF
GETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALS
FISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRI
LQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVY
LYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESK
GT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50199210
NameBDBM50199210
Synonyms:6-(3-chlorophenyl)-3-[2-(4-morpholinylmethyl)-6-quinolinyl]-thieno[3,2-d]pyrimidin-4(3H)-one | CHEMBL384825
TypeSmall organic molecule
Emp. Form.C26H21ClN4O2S
Mol. Mass.488.989
SMILESClc1cccc(c1)-c1cc2ncn(-c3ccc4nc(CN5CCOCC5)ccc4c3)c(=O)c2s1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a