Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetC-X-C chemokine receptor type 2
LigandBDBM50211456
Substrate/Competitorn/a
Meas. Tech.ChEMBL_455595
Ki 2±n/a nM
Citation Chao, JTaveras, AGChao, JAki, CDwyer, MYu, YPurakkattle, BRindgen, DJakway, JHipkin, WFosetta, JFan, XLundell, DFine, JMinnicozzi, MPhillips, JMerritt, JR C(4)-alkyl substituted furanyl cyclobutenediones as potent, orally bioavailable CXCR2 and CXCR1 receptor antagonists. Bioorg Med Chem Lett17:3778-83 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
C-X-C chemokine receptor type 2
Name:C-X-C chemokine receptor type 2
Synonyms:C-X-C chemokine receptor type 2 (CXCR-2) | C-X-C chemokine receptor type 2 (CXCR2) | CD_antigen=CD182 | CDw128b | CXCR-2 | Chemokine receptor type 2 (CXCR2) | GRO/MGSA receptor | High affinity interleukin-8 receptor B | IL-8 receptor type 2 | IL-8R B | Interleukin-8 receptor B
Type:Protein
Mol. Mass.:40767.88
Organism:Homo sapiens (Human)
Description:P25025
Residue:360
Sequence:
MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYFVVIIYALVFL
LSLLGNSLVMLVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCK
VVSLLKEVNFYSGILLLACISVDRYLAIVHATRTLTQKRYLVKFICLSIWGLSLLLALPV
LLFRRTVYSSNVSPACYEDMGNNTANWRMLLRILPQSFGFIVPLLIMLFCYGFTLRTLFK
AHMGQKHRAMRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQETCERRNHIDRALDATE
ILGILHSCLNPLIYAFIGQKFRHGLLKILAIHGLISKDSLPKDSRPSFVGSSSGHTSTTL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50211456
NameBDBM50211456
Synonyms:(R)-2-hydroxy-3-(2-(1-(4-isopropylfuran-2-yl)ethylamino)-3,4-dioxocyclobut-1-enylamino)-N,N-dimethylbenzamide | CHEMBL246941
TypeSmall organic molecule
Emp. Form.C22H25N3O5
Mol. Mass.411.451
SMILESCC(C)c1coc(c1)[C@@H](C)Nc1c(Nc2cccc(C(=O)N(C)C)c2O)c(=O)c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a