Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine A2b receptor
LigandBDBM50211685
Substrate/Competitorn/a
Meas. Tech.ChEMBL_436396
IC50 640±n/a nM
Citation Vidal, BNueda, AEsteve, CDomenech, TBenito, SReinoso, RFPont, MCalbet, MLópez, RCadavid, MILoza, MICárdenas, AGodessart, NBeleta, JWarrellow, GRyder, H Discovery and characterization of 4'-(2-furyl)-N-pyridin-3-yl-4,5'-bipyrimidin-2'-amine (LAS38096), a potent, selective, and efficacious A2B adenosine receptor antagonist. J Med Chem50:2732-6 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine A2b receptor
Name:Adenosine A2b receptor
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:36130.09
Organism:Mus musculus
Description:ChEMBL_11831
Residue:332
Sequence:
MQLETQDALYVALELVIAALAVAGNVLVCAAVGASSALQTPTNYFLVSLATADVAVGLFA
IPFAITISLGFCTDFHGCLFLACFVLVLTQSSIFSLLAVAVDRYLAIRVPLRYKGLVTGT
RARGIIAVLWVLAFGIGLTPFLGWNSKDSATSNCTELGDGIANKSCCPVTCLFENVVPMS
YMVYFNFFGCVLPPLLIMLVIYIKIFMVACKQLQRMELMDHSRTTLQREIHAAKSLAMIV
GIFALCWLPVHAINCITLFHPALAKDKPKWVMNVAILLSHANSVVNPIVYAYRNRDFRYS
FHKIISRYVLCQAETKGGSGQAGAQSTLSLGL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50211685
NameBDBM50211685
Synonyms:4'-(2-furyl)-N-pyridin-3-yl-4,5'-bipyrimidin-2'-amine | 4'-(furan-2-yl)-N-(pyridin-3-yl)-4,5'-bipyrimidin-2'-amine | CHEMBL375293
TypeSmall organic molecule
Emp. Form.C17H12N6O
Mol. Mass.316.3168
SMILESN(c1cccnc1)c1ncc(-c2ccncn2)c(n1)-c1ccco1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a