Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetArabinosyltransferase A
LigandBDBM50215418
Substrate/Competitorn/a
Meas. Tech.ChEMBL_447683
IC50 3440000±n/a nM
Citation Pathak, AKPathak, VRiordan, JRSuling, WJGurcha, SSBesra, GSReynolds, RC Synthesis of symmetrical C- and pseudo-symmetrical O-linked disaccharide analogs for arabinosyltransferase inhibitory activity in Mycobacterium tuberculosis. Bioorg Med Chem Lett17:4527-30 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Arabinosyltransferase A
Name:Arabinosyltransferase A
Synonyms:Probable arabinosyltransferase A
Type:PROTEIN
Mol. Mass.:115749.86
Organism:Mycobacterium tuberculosis
Description:ChEMBL_447683
Residue:1094
Sequence:
MPHDGNERSHRIARLAAVVSGIAGLLLCGIVPLLPVNQTTATIFWPQGSTADGNITQITA
PLVSGAPRALDISIPCSAIATLPANGGLVLSTLPAGGVDTGKAGLFVRANQDTVVVAFRD
SVAAVAARSTIAAGGCSALHIWADTGGAGADFMGIPGGAGTLPPEKKPQVGGIFTDLKVG
AQPGLSARVDIDTRFITTPGALKKAVMLLGVLAVLVAMVGLAALDRLSRGRTLRDWLTRY
RPRVRVGFASRLADAAVIATLLLWHVIGATSSDDGYLLTVARVAPKAGYVANYYRYFGTT
EAPFDWYTSVLAQLAAVSTAGVWMRLPATLAGIACWLIVSRFVLRRLGPGPGGLASNRVA
VFTAGAVFLSAWLPFNNGLRPEPLIALGVLVTWVLVERSIALGRLAPAAVAIIVATLTAT
LAPQGLIALAPLLTGARAIAQRIRRRRATDGLLAPLAVLAAALSLITVVVFRDQTLATVA
ESARIKYKVGPTIAWYQDFLRYYFLTVESNVEGSMSRRFAVLVLLFCLFGVLFVLLRRGR
VAGLASGPAWRLIGTTAVGLLLLTFTPTKWAVQFGAFAGLAGVLGAVTAFTFARIGLHSR
RNLTLYVTALLFVLAWATSGINGWFYVGNYGVPWYDIQPVIASHPVTSMFLTLSILTGLL
AAWYHFRMDYAGHTEVKDNRRNRILASTPLLVVAVIMVAGEVGSMAKAAVFRYPLYTTAK
ANLTALSTGLSSCAMADDVLAEPDPNAGMLQPVPGQAFGPDGPLGGISPVGFKPEGVGED
LKSDPVVSKPGLVNSDASPNKPNAAITDSAGTAGGKGPVGINGSHAALPFGLDPARTPVM
GSYGENNLAATATSAWYQLPPRSPDRPLVVVSAAGAIWSYKEDGDFIYGQSLKLQWGVTG
PDGRIQPLGQVFPIDIGPQPAWRNLRFPLAWAPPEADVARIVAYDPNLSPEQWFAFTPPR
VPVLESLQRLIGSATPVLMDIATAANFPCQRPFSEHLGIAELPQYRILPDHKQTAASSNL
WQSSSTGGPFLFTQALLRTSTIATYLRGDWYRDWGSVEQYHRLVPADQAPDAVVEEGVIT
VPGWGRPGPIRALP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50215418
NameBDBM50215418
Synonyms:(2R,3S,4S,5R)-2-((bis(cyclohexylmethyl)amino)methyl)-5-(2-((2R,3S,4S,5R)-5-((bis(cyclohexylmethyl)amino)methyl)-3,4-dihydroxy-tetrahydrofuran-2-yl)ethyl)-tetrahydrofuran-3,4-diol | CHEMBL231743
TypeSmall organic molecule
Emp. Form.C40H72N2O6
Mol. Mass.677.0095
SMILESO[C@H]1[C@H](O)[C@@H](CN(CC2CCCCC2)CC2CCCCC2)O[C@@H]1CC[C@H]1O[C@H](CN(CC2CCCCC2)CC2CCCCC2)[C@@H](O)[C@@H]1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a