Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMatrix metalloproteinase-7 (MMP7)
LigandBDBM50216004
Substrate/Competitorn/a
Meas. Tech.ChEMBL_456577
Ki 635±n/a nM
Citation Gilmore, JLKing, BWAsakawa, NHarrison, KTebben, ASheppeck, JELiu, RQCovington, MDuan, JJ Synthesis and structure-activity relationship of a novel, non-hydroxamate series of TNF-alpha converting enzyme inhibitors. Bioorg Med Chem Lett17:4678-82 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Matrix metalloproteinase-7 (MMP7)
Name:Matrix metalloproteinase 7
Synonyms:Matrix metalloproteinase 7 | Matrix metalloproteinase-7 (MMP-7)
Type:Enzyme
Mol. Mass.:29681.54
Organism:Homo sapiens (Human)
Description:P09237
Residue:267
Sequence:
MRLTVLCAVCLLPGSLALPLPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLK
EMQKFFGLPITGMLNSRVIEIMQKPRCGVPDVAEYSLFPNSPKWTSKVVTYRIVSYTRDL
PHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAF
APGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGD
PQNFKLSQDDIKGIQKLYGKRSNSRKK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50216004
NameBDBM50216004
Synonyms:4-((2-methylquinolin-4-yl)methoxy)-N-(4-((5-thioxo-4,5-dihydro-1H-1,2,4-triazol-3-yl)methyl)-tetrahydro-2H-pyran-4-yl)benzamide | CHEMBL247140
TypeSmall organic molecule
Emp. Form.C26H27N5O3S
Mol. Mass.489.589
SMILESCc1cc(COc2ccc(cc2)C(=O)NC2(Cc3n[nH]c(=S)[nH]3)CCOCC2)c2ccccc2n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a