Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target15-Lipoxygenase-2 (15-LOX-2)
LigandBDBM50222282
Substrate/Competitorn/a
Meas. Tech.ChEMBL_457827
IC50>100000±n/a nM
Citation Vasquez-Martinez, YOhri, RVKenyon, VHolman, TRSepúlveda-Boza, S Structure-activity relationship studies of flavonoids as potent inhibitors of human platelet 12-hLO, reticulocyte 15-hLO-1, and prostate epithelial 15-hLO-2. Bioorg Med Chem15:7408-25 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
15-Lipoxygenase-2 (15-LOX-2)
Name:15-Lipoxygenase-2 (15-LOX-2)
Synonyms:15-LOX-2 | 15-Lipo-oxygenase type 2 (15-LOX-2) | 15-lipoxygenase 2 | Arachidonate 15-lipoxygenase type II | Arachidonate 15-lipoxygenase, type II | Arachidonate 15-lipoxygenase-2 | Epithelial 15-lipoxygenase-2
Type:Protein
Mol. Mass.:75850.40
Organism:Homo sapiens (Human)
Description:n/a
Residue:676
Sequence:
MAEFRVRVSTGEAFGAGTWDKVSVSIVGTRGESPPLPLDNLGKEFTAGAEEDFQVTLPED
VGRVLLLRVHKAPPVLPLLGPLAPDAWFCRWFQLTPPRGGHLLFPCYQWLEGAGTLVLQE
GTAKVSWADHHPVLQQQRQEELQARQEMYQWKAYNPGWPHCLDEKTVEDLELNIKYSTAK
NANFYLQAGSAFAEMKIKGLLDRKGLWRSLNEMKRIFNFRRTPAAEHAFEHWQEDAFFAS
QFLNGLNPVLIRRCHYLPKNFPVTDAMVASVLGPGTSLQAELEKGSLFLVDHGILSGIQT
NVINGKPQFSAAPMTLLYQSPGCGPLLPLAIQLSQTPGPNSPIFLPTDDKWDWLLAKTWV
RNAEFSFHEALTHLLHSHLLPEVFTLATLRQLPHCHPLFKLLIPHTRYTLHINTLARELL
IVPGQVVDRSTGIGIEGFSELIQRNMKQLNYSLLCLPEDIRTRGVEDIPGYYYRDDGMQI
WGAVERFVSEIIGIYYPSDESVQDDRELQAWVREIFSKGFLNQESSGIPSSLETREALVQ
YVTMVIFTCSAKHAAVSAGQFDSCAWMPNLPPSMQLPPPTSKGLATCEGFIATLPPVNAT
CDVILALWLLSKEPGDQRPLGTYPDEHFTEEAPRRSIATFQSRLAQISRGIQERNQGLVL
PYTYLDPPLIENSVSI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50222282
NameBDBM50222282
Synonyms:3-hydroxy-2-t-butyl-4H-benzopyran-4-one | CHEMBL239023
TypeSmall organic molecule
Emp. Form.C13H14O3
Mol. Mass.218.2485
SMILESCC(C)(C)c1oc2ccccc2c(=O)c1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a