Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target11-beta-hydroxysteroid dehydrogenase 2
LigandBDBM50224221
Substrate/Competitorn/a
Meas. Tech.ChEMBL_450658
IC50 380±n/a nM
Citation Yuan, CSt Jean, DJLiu, QCai, LLi, AHan, NMoniz, GAskew, BHungate, RWJohansson, LTedenborg, LPyring, DWilliams, MHale, CChen, MCupples, RZhang, JJordan, SBartberger, MDSun, YEmery, MWang, MFotsch, C The discovery of 2-anilinothiazolones as 11beta-HSD1 inhibitors. Bioorg Med Chem Lett17:6056-61 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
11-beta-hydroxysteroid dehydrogenase 2
Name:11-beta-hydroxysteroid dehydrogenase 2
Synonyms:11-DH2 | 11-beta-HSD2 | 11-beta-Hydroxysteroid Dehydrogenase 2 (11-beta-HSD2) | 11-beta-hydroxysteroid dehydrogenase type 2 | 11-beta-hydroxysteroid dehydrogenase type 2 (11-beta-HSD2) | Corticosteroid 11-beta-dehydrogenase isozyme 2 | NAD-dependent 11-beta-hydroxysteroid dehydrogenase
Type:Enzyme
Mol. Mass.:44141.72
Organism:Homo sapiens (Human)
Description:Purified recombinant human 11beta-HSD2.
Residue:405
Sequence:
MERWPWPSGGAWLLVAARALLQLLRSDLRLGRPLLAALALLAALDWLCQRLLPPPAALAV
LAAAGWIALSRLARPQRLPVATRAVLITGCDSGFGKETAKKLDSMGFTVLATVLELNSPG
AIELRTCCSPRLRLLQMDLTKPGDISRVLEFTKAHTTSTGLWGLVNNAGHNEVVADAELS
PVATFRSCMEVNFFGALELTKGLLPLLRSSRGRIVTVGSPAGDMPYPCLGAYGTSKAAVA
LLMDTFSCELLPWGVKVSIIQPGCFKTESVRNVGQWEKRKQLLLANLPQELLQAYGKDYI
EHLHGQFLHSLRLAMSDLTPVVDAITDALLAARPRRRYYPGQGLGLMYFIHYYLPEGLRR
RFLQAFFISHCLPRALQPGQPGTTPPQDAAQDPNLSPGPSPAVAR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50224221
NameBDBM50224221
Synonyms:5-cyclopentyl-2-(2-fluorophenylamino)thiazol-4(5H)-one | CHEMBL240269
TypeSmall organic molecule
Emp. Form.C14H15FN2OS
Mol. Mass.278.345
SMILESOc1nc(Nc2ccccc2F)sc1C1CCCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a