Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarboxypeptidase N, catalytic subunit
LigandBDBM50201438
Substrate/Competitorn/a
Meas. Tech.ChEMBL_452078
Ki 2±n/a nM
Citation Bunnage, MEBlagg, JSteele, JOwen, DRAllerton, CMcElroy, ABMiller, DRinger, TButcher, KBeaumont, KEvans, KGray, AJHolland, SJFeeder, NMoore, RSBrown, DG Discovery of potent& selective inhibitors of activated thrombin-activatable fibrinolysis inhibitor for the treatment of thrombosis. J Med Chem50:6095-103 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carboxypeptidase N, catalytic subunit
Name:Carboxypeptidase N, catalytic subunit
Synonyms:Anaphylatoxin inactivator | Arginine carboxypeptidase | CPN | Carboxypeptidase N catalytic chain | Carboxypeptidase N polypeptide 1 | Carboxypeptidase N small subunit | Kininase-1 | Lysine carboxypeptidase | Plasma carboxypeptidase B | SCPN | Serum carboxypeptidase N
Type:PROTEIN
Mol. Mass.:52293.66
Organism:Homo sapiens (Human)
Description:ChEMBL_1496379
Residue:458
Sequence:
MSDLLSVFLHLLLLFKLVAPVTFRHHRYDDLVRTLYKVQNECPGITRVYSIGRSVEGRHL
YVLEFSDHPGIHEPLEPEVKYVGNMHGNEALGRELMLQLSEFLCEEFRNRNQRIVQLIQD
TRIHILPSMNPDGYEVAAAQGPNKPGYLVGRNNANGVDLNRNFPDLNTYIYYNEKYGGPN
HHLPLPDNWKSQVEPETRAVIRWMHSFNFVLSANLHGGAVVANYPYDKSFEHRVRGVRRT
ASTPTPDDKLFQKLAKVYSYAHGWMFQGWNCGDYFPDGITNGASWYSLSKGMQDFNYLHT
NCFEITLELSCDKFPPEEELQREWLGNREALIQFLEQVHQGIKGMVLDENYNNLANAVIS
VSGINHDVTSGDHGDYFRLLLPGIYTVSATAPGYDPETVTVTVGPAEPTLVNFHLKRSIP
QVSPVRRAPSRRHGVRAKVQPQARKKEMEMRQLQRGPA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50201438
NameBDBM50201438
Synonyms:(+/-)-5-guanidino-2-(mercaptomethyl)pentanoic acid | 5-guanidino-2-(mercaptomethyl)pentanoic acid | CHEMBL236822
TypeSmall organic molecule
Emp. Form.C7H15N3O2S
Mol. Mass.205.278
SMILES[#7]\[#6](-[#7])=[#7]\[#6]-[#6]-[#6]-[#6](-[#6]-[#16])-[#6](-[#8])=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a