Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEndo-beta-N-acetylglucosaminidase
LigandBDBM50235890
Substrate/Competitorn/a
Meas. Tech.ChEMBL_462868
IC50 750000±n/a nM
Citation Ohara, CTakahashi, RMiyagawa, TYoshimura, YKato, AAdachi, ITakahata, H Synthesis of all stereoisomers of 3-hydroxypipecolic acid and 3-hydroxy-4,5-dehydropipecolic acid and their evaluation as glycosidase inhibitors. Bioorg Med Chem Lett18:1810-3 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Endo-beta-N-acetylglucosaminidase
Name:Endo-beta-N-acetylglucosaminidase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:83989.32
Organism:Homo sapiens (Human)
Description:ChEMBL_467019
Residue:743
Sequence:
MEAAAVTVTRSATRRRRRQLQGLAAPEAGTQEEQEDQEPRPRRRRPGRSIKDEEEETVFR
EVVSFSPDPLPVRYYDKDTTKPISFYLSSLEELLAWKPRLEDGFNVALEPLACRQPPLSS
QRPRTLLCHDMMGGYLDDRFIQGSVVQTPYAFYHWQCIDVFVYFSHHTVTIPPVGWTNTA
HRHGVCVLGTFITEWNEGGRLCEAFLAGDERSYQAVADRLVQITQFFRFDGWLINIENSL
SLAAVGNMPPFLRYLTTQLHRQVPGGLVLWYDSVVQSGQLKWQDELNQHNRVFFDSCDGF
FTNYNWREEHLERMLGQAGERRADVYVGVDVFARGNVVGGRFDTDKSLELIRKHGFSVAL
FAPGWVYECLEKKDFFQNQDKFWGRLERYLPTHSICSLPFVTSFCLGMGARRVCYGQEEA
VGPWYHLSAQEIQPLFGEHRLGGDGRGWVRTHCCLEDAWHGGSSLLVRGVIPPEVGNVAV
RLFSLQAPVPPKIYLSMVYKLEGPTDVTVALELTTGDAGSCHIGGISVLNAETSSRHSLR
PLRVPPTKLARWVGRCGRQLSGGWVQHCYEVSLRGCLLLDLLVCFSRPPGSREEESFTCR
LGEIQVVDAASLLAPLPQVQAVTISHIRWQPSASEREGPPALLQLSCTLHWSFLLSQVRC
FRIHCWGGMSDDSPGRELPRPEMPMFLGLAFATQYRIVDLLVEAAGPGQDRRMEFLVEPV
PKEGFRVPQAEWGRAVLLYSAPA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50235890
NameBDBM50235890
Synonyms:(2S,3S)-3-Hydroxybaikiain | (2S,3S)-3-hydroxy-1,2,3,6-tetrahydropyridine-2-carboxylic acid | CHEMBL403603
TypeSmall organic molecule
Emp. Form.C6H9NO3
Mol. Mass.143.1406
SMILESO[C@H]1C=CCN[C@@H]1C(O)=O |r,c:2|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a