Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine receptor A2
LigandBDBM50237083
Substrate/Competitorn/a
Meas. Tech.ChEMBL_463091
Ki 0.3±n/a nM
Citation Zhang, XRueter, JKChen, YMoorjani, MLanier, MCLin, EGross, RSTellew, JEWilliams, JPLechner, SMMarkison, SJoswig, TMalany, SSantos, MCastro-Palomino, JCCrespo, MIPrat, MGual, SDíaz, JLSaunders, JSlee, DH Synthesis of N-pyrimidinyl-2-phenoxyacetamides as adenosine A2A receptor antagonists. Bioorg Med Chem Lett18:1778-83 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine receptor A2
Name:Adenosine receptor
Synonyms:A2A adenosine receptor (hA2A) | ADENOSINE A2 | ADENOSINE A2a | ADORA2 | ADORA2A | Adenosine A2A receptor (A2AAR)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:44716.46
Organism:Homo sapiens (Human)
Description:P29274
Residue:412
Sequence:
MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAI
PFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTR
AKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYF
NFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVG
LFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFR
KIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNG
YALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50237083
NameBDBM50237083
Synonyms:CHEMBL256124 | N-(6-(3,5-dimethyl-1H-pyrazol-1-yl)-2-(5-methylfuran-2-yl)pyrimidin-4-yl)-2-(3-((ethyl(methyl)amino)methyl)phenoxy)acetamide
TypeSmall organic molecule
Emp. Form.C26H30N6O3
Mol. Mass.474.5548
SMILESCCN(C)Cc1cccc(OCC(=O)Nc2cc(nc(n2)-c2ccc(C)o2)-n2nc(C)cc2C)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a