Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCyclooxygenase
LigandBDBM50150484
Substrate/Competitorn/a
Meas. Tech.ChEMBL_508957
IC50>500000±n/a nM
Citation Ringbom, THuss, UStenholm, AFlock, SSkattebøl, LPerera, PBohlin, L Cox-2 inhibitory effects of naturally occurring and modified fatty acids. J Nat Prod64:745-9 (2001) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cyclooxygenase
Name:Cyclooxygenase
Synonyms:Cyclooxygenase-1
Type:PROTEIN
Mol. Mass.:68814.10
Organism:Bos taurus
Description:ChEMBL_547440
Residue:600
Sequence:
MSRQGISLRFPLLLLLLSPSPVLPADPGAPAPVNPCCYYPCQHQGICVRFGLDRYQCDCT
RTGYYGPNCTIPEIWTWLRTTLRPSPSFVHFLLTHGRWLWDFVNATFIRDKLMRLVLTVR
SNLIPSPPTYNVAHDYISWESFSNVSYYTRILPSVPRDCPTPMGTKGKKQLPDAEFLSRR
FLLRRKFIPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLER
QYQLRLFKDGKLKYQMLNGEVYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLMV
YATIWLREHNRVCDLLKAEHPTWGDEQLFQTARLILIGETIKIVIEEYVQQLSGYFLQLK
FDPELLFGAQFQYRNRIAMEFNQLYHWHPLMPDSFRVGPQDYSYEQFLFNTSMLVDYGVE
ALVDAFSRQPAGRIGGGRNIDHHILHVAVDVIKESRELRLQPFNEYRKRFGMKPYTSFQE
LTGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEMGAPFSLKGLLGNPIC
SPEYWKASTFGGDVGFNLVKTATLKKLVCLNTKTCPYVSFHVPDPHREDRPGVERPPTEL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50150484
NameBDBM50150484
Synonyms:(Z)-9-octadecenoic acid | (Z)-Octadec-9-enoic acid | CHEMBL8659 | OLEATE | Octadec-9-enoic acid | oleaic acid | oleicacid
TypeSmall organic molecule
Emp. Form.C18H34O2
Mol. Mass.282.4614
SMILESCCCCCCCC\C=C/CCCCCCCC(O)=O
Structure
n/a