Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAldehyde dehydrogenase 1, mitochondrial
LigandBDBM50250900
Substrate/Competitorn/a
Meas. Tech.ChEMBL_509471
IC50 280000±n/a nM
Citation Kawagishi, HMiyazawa, TKume, HArimoto, YInakuma, T Aldehyde dehydrogenase inhibitors from the mushroom Clitocybe clavipes. J Nat Prod65:1712-4 (2002) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Aldehyde dehydrogenase 1, mitochondrial
Name:Aldehyde dehydrogenase 1, mitochondrial
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:59519.82
Organism:Saccharomyces cerevisiae
Description:ChEMBL_509471
Residue:533
Sequence:
MLATRNLVPIIRASIKWRIKLSALHYCMSDAETSEALLEDNSAYINNEKHNLFLEKIFSD
YQPFKHDNRTQVSCSQHMRDYRPLLTLSSATRSVLFSLLASDMSIILSISPNTGILLCIG
HLLASDIEDVVIVLSRGSPLVDLASTRIFKLAQNGTLRFAIKRTTFQELRFLRKSKDENV
MEAATRGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDSSIFPNTRCA
YPSGYGPSAKIPCLSHKPNDILAYTGSTLVGRVVSKLAPEQVMKKVTLESGGKSTMAVFI
QHDVTWAVENTQFGVFDRQGQCCIAQSGYTVHRSTLSQIVENNLEKDPSYVLHVDTESDI
RGPFILKIHFESIPRRINSAKAENSKVLCGGPRENSVYLYPTLSATLTDECRIMKEEVFA
PIITILCVKTVDEAIQRGNNSKFGLAAYVTKENVHGIILSTALKTVKLFIICVHLASYQI
PFGGNKNSGMGAELGKRALENYTEGNHVLPVSLVKETLAPNTETASPARWPIH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50250900
NameBDBM50250900
Synonyms:(E)-8-oxo-9-oactadecenoic acid | CHEMBL465675
TypeSmall organic molecule
Emp. Form.C18H32O3
Mol. Mass.296.4449
SMILESCCCCCCCCC=CC(=O)CCCCCCC(O)=O |w:8.7|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a