Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetC-X-C chemokine receptor type 4 (CXCR4)
LigandBDBM50035696
Substrate/Competitorn/a
Meas. Tech.ChEMBL_529472
IC50 0.81±n/a nM
Citation Sohy, DParmentier, MSpringael, JY Allosteric transinhibition by specific antagonists in CCR2/CXCR4 heterodimers. J Biol Chem282:30062-9 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
C-X-C chemokine receptor type 4 (CXCR4)
Name:C-X-C chemokine receptor type 4
Synonyms:C-X-C chemokine receptor type 4 | CD_antigen=CD184 | CXC-R4 | CXCR-4 | FB22 | Fusin | HM89 | LCR1 | LESTR | Leukocyte-derived seven transmembrane domain receptor | NPYRL | SDF-1 receptor | Stromal cell-derived factor 1 receptor
Type:Enzyme
Mol. Mass.:39754.61
Organism:Homo sapiens (Human)
Description:P61073
Residue:352
Sequence:
MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYSIIFLTGIVGNGLVI
LVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVANWYFGNFLCKAVHVIYTVNL
YSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWIPALLLTIPDFIFANVSEA
DDRYICDRFYPNDLWVVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSKGHQKRKALKT
TVILILAFFACWLPYYIGISIDSFILLEIIKQGCEFENTVHKWISITEALAFFHCCLNPI
LYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSSFHSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50035696
NameBDBM50035696
Synonyms:1,1''-{1,4-phenylenebis(methylene)}-bis{1,4,8,11-tetraaza-cyclotetradecane} | 1,4,8,11-tetraazacyclotetradecanyl[4-(1,4,8,11-tetraazacyclotetradecanylmethyl)phenyl]methane | 1,4,8,11-tetraazacyclotetradecanyl[4-(1,4,8,11-tetraazacyclotetradecanylmethyl)phenyl]methane(8HBr.2H2O) | 1,4-bis((1,4,8,11-tetraazacyclotetradecan-1-yl)methyl)benzene | 11''-xylyl bis-1,4,8,11-tetraazacyclotetradecane | 11-{4-[4,8, 11-1,4,8,11tetraaza-cyclotetradec-1-ylmethyl]-benzyl}-1,4,8,11tetraaza-cyclotetradecane-1,4,8-tricarboxylic acid tri-tert-butyl ester | AMD-3100 | CHEMBL18442 | CHEMBL2311089 | PLERIXAFOR | PLERIXAFOR OCTAHYDROCHLORIDE | US9205085, MSX-162
TypeSmall organic molecule
Emp. Form.C28H54N8
Mol. Mass.502.782
SMILESC(N1CCCNCCNCCCNCC1)c1ccc(CN2CCCNCCNCCCNCC2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a