Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRegulatory protein E2
LigandBDBM50035218
Substrate/Competitorn/a
Meas. Tech.ChEMBL_532975
Kd>400000±n/a nM
Citation Saitoh, TKuramochi, KImai, TTakata, KTakehara, MKobayashi, SSakaguchi, KSugawara, F Podophyllotoxin directly binds a hinge domain in E2 of HPV and inhibits an E2/E7 interaction in vitro. Bioorg Med Chem16:5815-25 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Regulatory protein E2
Name:Regulatory protein E2
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:45494.82
Organism:Human papillomavirus type 1a
Description:ChEMBL_532977
Residue:401
Sequence:
MENLSSRLDLLQEQLMNLYEQDSKLIEDQIKQWNLIRQEQVLFHFARKNGVMRIGLQAVP
SLASSQEKAKTAIEMVLHLESLKDSPYGTEDWSLQDTSRELFLAPPAGTFKKSGSTLEVT
YDNNPDNQTRHTIWNHVYYQNGDDVWRKVSSGVDAVGVYYLEHDGYKNYYVLFAEEASKY
STTGQYAVNYRGKRFTNVMSSTSSPRAAGAPAVHSDYPTLSESDTAQQSTSIDYTELPGQ
GETSQVRQRQQKTPVRRRPYGRRRSRSPRGGGRREGESTPSRTPGSVPSARDVGSIHTTP
QKGHSSRLRRLLQEAWDPPVVCVKGGANQLKCLRYRLKASTQVDFDSISTTWHWTDRKNT
ERIGSARMLVKFIDEAQREKFLERVALPRSVSVFLGQFNGS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50035218
NameBDBM50035218
Synonyms:CHEMBL61 | PODOFILOX | Podophyllinic acid lactone | Podophyllotoxin (PTOX) | podophyllotoxin
TypeSmall organic molecule
Emp. Form.C22H22O8
Mol. Mass.414.4053
SMILESCOc1cc(cc(OC)c1OC)[C@H]1[C@@H]2[C@H](COC2=O)[C@@H](O)c2cc3OCOc3cc12 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a