Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetThyrotropin-releasing hormone receptor 2
LigandBDBM50261174
Substrate/Competitorn/a
Meas. Tech.ChEMBL_533265
IC50 19000±n/a nM
Citation Carroll, ARUrban, SLamb, JMoni, RGuymer, GPForster, PIQuinn, RJ Corymbones A and B, phloroglucinols with thyrotropin releasing hormone receptor 2 binding affinity from the flowers of Corymbia peltata. J Nat Prod71:881-3 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Thyrotropin-releasing hormone receptor 2
Name:Thyrotropin-releasing hormone receptor 2
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:39044.21
Organism:Rattus norvegicus
Description:ChEMBL_532304
Residue:352
Sequence:
MDGPSNVSLIHGDTTLGLPEYKVVSVFLVLLVCTLGIVGNAMVILVVLTSRDMHTPTNCY
LVSLALADLLVLLAAGLPNVSDSLVGHWIYGRAGCLGITYFQYLGINVSSFSILAFTVER
YIAICHPLRAQTVCTVARAKRIIAGIWGVTSLYCLLWFFLVDLNVRDNQRLECGYKVPRG
LYLPIYLLDFAVFFIGPLLVTLVLYGLIGRILFQSPLSQEAWQKERQPHGQSEAAPGNCS
RAKSSRKQATRMLAVVVLLFAVLWTPYRTLVLLNSFVAQPFLDPWVLLFCRTCVYTNSAV
NPVVYSLMSQKFRAAFLKLCWCRAAGPQRRAARVLTSNYSAAQETSEGTEKM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50261174
NameBDBM50261174
Synonyms:CHEMBL496930 | corymbone B
TypeSmall organic molecule
Emp. Form.C31H38O7
Mol. Mass.522.6292
SMILESCC(C)CC(C1C(=O)C(C)(C)C(=O)C(C)(C)C1=O)c1c(O)c(C)c(O)c(C(=O)CCc2ccccc2)c1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a