Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-Hydroxytryptamine receptor 7 (5-HT7)
LigandBDBM50261126
Substrate/Competitorn/a
Meas. Tech.ChEMBL_556688
IC50 20±n/a nM
Citation Yoon, JYoo, EAKim, JYPae, ANRhim, HPark, WKKong, JYPark Choo, HY Preparation of piperazine derivatives as 5-HT7 receptor antagonists. Bioorg Med Chem16:5405-12 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
5-Hydroxytryptamine receptor 7 (5-HT7)
Name:Serotonin (5-HT) receptor
Synonyms:5-HT-7 | 5-HT-X | 5-HT7 | 5-HT7L | 5-HT7S | 5-HT7b | 5-hydroxytryptamine receptor 7 | 5HT7 | HTR7
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:53573.08
Organism:Homo sapiens (Human)
Description:P34969
Residue:479
Sequence:
MMDVNSSGRPDLYGHLRSFLLPEVGRGLPDLSPDGGADPVAGSWAPHLLSEVTASPAPTW
DAPPDNASGCGEQINYGRVEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSNYLI
VSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISIDR
YLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDFGYT
IYSTAVAFYIPMSVMLFMYYQIYKAARKSAAKHKFPGFPRVEPDSVIALNGIVKLQKEVE
ECANLSRLLKHERKNISIFKREQKAATTLGIIVGAFTVCWLPFFLLSTARPFICGTSCSC
IPLWVERTFLWLGYANSLINPFIYAFFNRDLRTTYRSLLQCQYRNINRKLSAAGMHEALK
LAERPERPEFVLRACTRRVLLRPEKRPPVSVWVLQSPDHHNWLADKMLTTVEKKVMIHD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50261126
NameBDBM50261126
Synonyms:CHEMBL497749 | N-(3-(4-(2-methoxyphenyl)piperazin-1-yl)propyl)naphthalene-2-sulfonamide | Naphthalene-2-sulfonic acid {3-[4-(2-methoxyphenyl)-piperazin-1-yl]-propyl}-amide
TypeSmall organic molecule
Emp. Form.C24H29N3O3S
Mol. Mass.439.57
SMILESCOc1ccccc1N1CCN(CCCNS(=O)(=O)c2ccc3ccccc3c2)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a