Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLanosterol synthase
LigandBDBM50271530
Substrate/Competitorn/a
Meas. Tech.ChEMBL_556115
IC50 63±n/a nM
Citation Fouchet, MHDonche, FMartin, CBouillot, AJunot, CBoullay, ABPotvain, FMagny, SDCoste, HWalker, MIssandou, MDodic, N Design and evaluation of a novel series of 2,3-oxidosqualene cyclase inhibitors with low systemic exposure, relationship between pharmacokinetic properties and ocular toxicity. Bioorg Med Chem16:6218-32 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Lanosterol synthase
Name:Lanosterol synthase
Synonyms:2,3-epoxysqualene--lanosterol cyclase | OSC | Oxidosqualene--lanosterol cyclase
Type:PROTEIN
Mol. Mass.:83309.32
Organism:Homo sapiens (Human)
Description:ChEMBL_84
Residue:732
Sequence:
MTEGTCLRRRGGPYKTEPATDLGRWRLNCERGRQTWTYLQDERAGREQTGLEAYALGLDT
KNYFKDLPKAHTAFEGALNGMTFYVGLQAEDGHWTGDYGGPLFLLPGLLITCHVARIPLP
AGYREEIVRYLRSVQLPDGGWGLHIEDKSTVFGTALNYVSLRILGVGPDDPDLVRARNIL
HKKGGAVAIPSWGKFWLAVLNVYSWEGLNTLFPEMWLFPDWAPAHPSTLWCHCRQVYLPM
SYCYAVRLSAAEDPLVQSLRQELYVEDFASIDWLAQRNNVAPDELYTPHSWLLRVVYALL
NLYEHHHSAHLRQRAVQKLYEHIVADDRFTKSISIGPISKTINMLVRWYVDGPASTAFQE
HVSRIPDYLWMGLDGMKMQGTNGSQIWDTAFAIQALLEAGGHHRPEFSSCLQKAHEFLRL
SQVPDNPPDYQKYYRQMRKGGFSFSTLDCGWIVSDCTAEALKAVLLLQEKCPHVTEHIPR
ERLCDAVAVLLNMRNPDGGFATYETKRGGHLLELLNPSEVFGDIMIDYTYVECTSAVMQA
LKYFHKRFPEHRAAEIRETLTQGLEFCRRQQRADGSWEGSWGVCFTYGTWFGLEAFACMG
QTYRDGTACAEVSRACDFLLSRQMADGGWGEDFESCEERRYLQSAQSQIHNTCWAMMGLM
AVRHPDIEAQERGVRCLLEKQLPNGDWPQENIAGVFNKSCAISYTSYRNIFPIWALGRFS
QLYPERALAGHP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50271530
NameBDBM50271530
Synonyms:CHEMBL483918 | N-[2-(4-(4-((Pyrolidin-1-yl)methyl)phenyl)phenyl)ethyl]-4-chlorobenzenesulfonamide
TypeSmall organic molecule
Emp. Form.C25H27ClN2O2S
Mol. Mass.455.012
SMILESClc1ccc(cc1)S(=O)(=O)NCCc1ccc(cc1)-c1ccc(CN2CCCC2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a