Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLysophosphatidic acid receptor Edg-4
LigandBDBM50271763
Substrate/Competitorn/a
Meas. Tech.ChEMBL_556426
IC50 21.8±n/a nM
Citation Fells, JITsukahara, RFujiwara, YLiu, JPerygin, DHOsborne, DATigyi, GParrill, AL Identification of non-lipid LPA3 antagonists by virtual screening. Bioorg Med Chem16:6207-17 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Lysophosphatidic acid receptor Edg-4
Name:Lysophosphatidic acid receptor Edg-4
Synonyms:LPA receptor 2 | LPA-2 | Lysophosphatidic acid receptor 2
Type:PROTEIN
Mol. Mass.:39103.44
Organism:Homo sapiens (Human)
Description:ChEMBL_1451385
Residue:351
Sequence:
MVIMGQCYYNETIGFFYNNSGKELSSHWRPKDVVVVALGLTVSVLVLLTNLLVIAAIASN
RRFHQPIYYLLGNLAAADLFAGVAYLFLMFHTGPRTARLSLEGWFLRQGLLDTSLTASVA
TLLAIAVERHRSVMAVQLHSRLPRGRVVMLIVGVWVAALGLGLLPAHSWHCLCALDRCSR
MAPLLSRSYLAVWALSSLLVFLLMVAVYTRIFFYVRRRVQRMAEHVSCHPRYRETTLSLV
KTVVIILGAFVVCWTPGQVVLLLDGLGCESCNVLAVEKYFLLLAEANSLVNAAVYSCRDA
EMRRTFRRLLCCACLRQSTRESVHYTSSAQGGASTRIMLPENGHPLMDSTL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50271763
NameBDBM50271763
Synonyms:3-[3-(3-Carboxy-acryloylamino)-phenylcarbamoyl]-acrylic acid | 4,4'-(1,3-phenylenebis(azanediyl))bis(4-oxobut-2-enoic acid) | CHEMBL519002
TypeSmall organic molecule
Emp. Form.C14H12N2O6
Mol. Mass.304.2549
SMILESOC(=O)\C=C\C(=O)Nc1cccc(NC(=O)\C=C\C(O)=O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a