Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLysophosphatidic acid receptor 3 (LPAR3)
LigandBDBM50241460
Substrate/Competitorn/a
Meas. Tech.ChEMBL_556428
Ki 316.6±n/a nM
Citation Fells, JITsukahara, RFujiwara, YLiu, JPerygin, DHOsborne, DATigyi, GParrill, AL Identification of non-lipid LPA3 antagonists by virtual screening. Bioorg Med Chem16:6207-17 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Lysophosphatidic acid receptor 3 (LPAR3)
Name:Lysophosphatidic acid receptor 1/3
Synonyms:Lysophosphatidic acid receptor Edg-7
Type:Enzyme
Mol. Mass.:40149.72
Organism:Homo sapiens (Human)
Description:Q9UBY5
Residue:353
Sequence:
MNECHYDKHMDFFYNRSNTDTVDDWTGTKLVIVLCVGTFFCLFIFFSNSLVIAAVIKNRK
FHFPFYYLLANLAAADFFAGIAYVFLMFNTGPVSKTLTVNRWFLRQGLLDSSLTASLTNL
LVIAVERHMSIMRMRVHSNLTKKRVTLLILLVWAIAIFMGAVPTLGWNCLCNISACSSLA
PIYSRSYLVFWTVSNLMAFLIMVVVYLRIYVYVKRKTNVLSPHTSGSISRRRTPMKLMKT
VMTVLGAFVVCWTPGLVVLLLDGLNCRQCGVQHVKRWFLLLALLNSVVNPIIYSYKDEDM
YGTMKKMICCFSQENPERRPSRIPSTVLSRSDTGSQYIEDSISQGAVCNKSTS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50241460
NameBDBM50241460
Synonyms:4-(3-benzamidophenylamino)-4-oxobut-2-enoic acid | CHEMBL261872
TypeSmall organic molecule
Emp. Form.C17H14N2O4
Mol. Mass.310.3041
SMILESOC(=O)\C=C/C(=O)Nc1cccc(NC(=O)c2ccccc2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a