Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetC5a anaphylatoxin chemotactic receptor (C5aR)
LigandBDBM50251407
Substrate/Competitorn/a
Meas. Tech.ChEMBL_488512
Ki 13±n/a nM
Citation Gong, YBarbay, JKBuntinx, MLi, JWauwe, JVClaes, CLommen, GVHornby, PJHe, W Design and optimization of aniline-substituted tetrahydroquinoline C5a receptor antagonists. Bioorg Med Chem Lett18:3852-5 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
C5a anaphylatoxin chemotactic receptor (C5aR)
Name:C5a anaphylatoxin chemotactic receptor
Synonyms:C5a anaphylatoxin chemotactic receptor | C5a-R | C5aR | CD_antigen=CD88
Type:Enzyme
Mol. Mass.:39347.68
Organism:Homo sapiens (Human)
Description:P21730
Residue:350
Sequence:
MDSFNYTTPDYGHYDDKDTLDLNTPVDKTSNTLRVPDILALVIFAVVFLVGVLGNALVVW
VTAFEAKRTINAIWFLNLAVADFLSCLALPILFTSIVQHHHWPFGGAACSILPSLILLNM
YASILLLATISADRFLLVFKPIWCQNFRGAGLAWIACAVAWGLALLLTIPSFLYRVVREE
YFPPKVLCGVDYSHDKRRERAVAIVRLVLGFLWPLLTLTICYTFILLRTWSRRATRSTKT
LKVVVAVVASFFIFWLPYQVTGIMMSFLEPSSPTFLLLKKLDSLCVSFAYINCCINPIIY
VVAGQGFQGRLRKSLPSLLRNVLTEESVVRESKSFTRSTVDTMAQKTQAV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50251407
NameBDBM50251407
Synonyms:(5-chloro-2-(2-(2,6-diethylphenyl)-4-methoxy-5,6,7,8-tetrahydroquinolin-5-ylamino)phenyl)methanol | CHEMBL479395
TypeSmall organic molecule
Emp. Form.C27H31ClN2O2
Mol. Mass.451
SMILESCCc1cccc(CC)c1-c1cc(OC)c2C(CCCc2n1)Nc1ccc(Cl)cc1CO
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a