Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLuciferase
LigandBDBM50261811
Substrate/Competitorn/a
Meas. Tech.ChEMBL_509645
IC50 69±n/a nM
Citation Heitman, LHvan Veldhoven, JPZweemer, AMYe, KBrussee, JIJzerman, AP False positives in a reporter gene assay: identification and synthesis of substituted N-pyridin-2-ylbenzamides as competitive inhibitors of firefly luciferase. J Med Chem51:4724-9 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Luciferase
Name:Luciferase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:60126.66
Organism:Luciola lateralis
Description:ChEMBL_786225
Residue:548
Sequence:
MENMENDENIVYGPEPFYPIEEGSAGAQLRKYMDRYAKLGAIAFTNALTGVDYTYAEYLE
KSCCLGEALKNYGLVVDGRIALCSENCEEFFIPVLAGLFIGVGVAPTNEIYTLRELVHSL
GISKPTIVFSSKKGLDKVITVQKTVTAIKTIVILDSKVDYRGYQSMDNFIKKNTPQGFKG
SSFKTVEVNRKEQVALIMNSSGSTGLPKGVQLTHENAVTRFSHARDPIYGNQVSPGTAIL
TVVPFHHGFGMFTTLGYLTCGFRIVMLTKFDEETFLKTLQDYKCSSVILVPTLFAILNRS
ELLDKYDLSNLVEIASGGAPLSKEIGEAVARRFNLPGVRQGYGLTETTSAIIITPEGDDK
PGASGKVVPLFKAKVIDLDTKKTLGPNRRGEVCVKGPMLMKGYVDNPEATREIIDEEGWL
HTGDIGYYDEEKHFFIVDRLKSLIKYKGYQVPPAELESVLLQHPNIFDAGVAGVPDPIAG
ELPGAVVVLEKGKSMTEKEVMDYVASQVSNAKRLRGGVRFVDEVPKGLTGKIDGKAIREI
LKKPVAKM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50261811
NameBDBM50261811
Synonyms:CHEMBL467379 | N-(5-Phenylpyridin-2-yl)benzamide
TypeSmall organic molecule
Emp. Form.C18H14N2O
Mol. Mass.274.3166
SMILESO=C(Nc1ccc(cn1)-c1ccccc1)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a