Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPeroxisome proliferator-activated receptor gamma
LigandBDBM50265213
Substrate/Competitorn/a
Meas. Tech.ChEMBL_496449
IC50 200±n/a nM
Citation Sundriyal, SViswanad, BRamarao, PChakraborti, AKBharatam, PV New PPARgamma ligands based on barbituric acid: virtual screening, synthesis and receptor binding studies. Bioorg Med Chem Lett18:4959-62 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Peroxisome proliferator-activated receptor gamma
Name:Peroxisome proliferator-activated receptor gamma
Synonyms:Nuclear receptor subfamily 1 group C member 3 | PPAR-gamma
Type:PROTEIN
Mol. Mass.:57593.55
Organism:Mus musculus
Description:ChEMBL_1453700
Residue:505
Sequence:
MGETLGDSPVDPEHGAFADALPMSTSQEITMVDTEMPFWPTNFGISSVDLSVMEDHSHSF
DIKPFTTVDFSSISAPHYEDIPFTRADPMVADYKYDLKLQEYQSAIKVEPASPPYYSEKT
QLYNRPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNC
RIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLR
ALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQE
QSKEVAIRIFQGCQFRSVEAVQEITEYAKNIPGFINLDLNDQVTLLKYGVHEIIYTMLAS
LMNKDGVLISEGQGFMTREFLKNLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVII
LSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKVLQKMTDLRQIVTEHVQL
LHVIKKTETDMSLHPLLQEIYKDLY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50265213
NameBDBM50265213
Synonyms:5-(4-((4-methoxyphenoxy)methyl)benzylidene)pyrimidine-2,4,6(1H,3H,5H)-trione | CHEMBL523593
TypeSmall organic molecule
Emp. Form.C20H18N2O6
Mol. Mass.382.3667
SMILES[#6]-[#8]-c1ccc(-[#8]-[#6]-[#6]-[#8]-c2ccc(\[#6]=[#6]-3\[#6](=O)-[#7]-[#6](=O)-[#7]-[#6]-3=O)cc2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a