Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGRIA2
LigandBDBM50253650
Substrate/Competitorn/a
Meas. Tech.ChEMBL_512484
IC50 7600±n/a nM
Citation Cruz, LAEstébanez-Perpiñá, EPfaff, SBorngraeber, SBao, NBlethrow, JFletterick, RJEngland, PM 6-Azido-7-nitro-1,4-dihydroquinoxaline-2,3-dione (ANQX) forms an irreversible bond to the active site of the GluR2 AMPA receptor. J Med Chem51:5856-60 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
GRIA2
Name:Glutamate receptor AMPA 2/3
Synonyms:AMPA-selective glutamate receptor 2 | GluR-2 | GluR-B | GluR-K2 | Glutamate AMPA 2 | Glutamate receptor 2 | Glutamate receptor ionotropic AMPA | Glutamate receptor ionotropic, AMPA 2
Type:Enzyme Catalytic Domain
Mol. Mass.:98825.96
Organism:Homo sapiens (Human)
Description:Glutamate AMPA 2 GRIA2 HUMAN::P42262
Residue:883
Sequence:
MQKIMHISVLLSPVLWGLIFGVSSNSIQIGGLFPRGADQEYSAFRVGMVQFSTSEFRLTP
HIDNLEVANSFAVTNAFCSQFSRGVYAIFGFYDKKSVNTITSFCGTLHVSFITPSFPTDG
THPFVIQMRPDLKGALLSLIEYYQWDKFAYLYDSDRGLSTLQAVLDSAAEKKWQVTAINV
GNINNDKKDEMYRSLFQDLELKKERRVILDCERDKVNDIVDQVITIGKHVKGYHYIIANL
GFTDGDLLKIQFGGANVSGFQIVDYDDSLVSKFIERWSTLEEKEYPGAHTTTIKYTSALT
YDAVQVMTEAFRNLRKQRIEISRRGNAGDCLANPAVPWGQGVEIERALKQVQVEGLSGNI
KFDQNGKRINYTINIMELKTNGPRKIGYWSEVDKMVVTLTELPSGNDTSGLENKTVVVTT
ILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKI
WNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLD
PLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEFEDGRETQSSESTNEFGIFNSLWF
SLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDL
SKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGK
YAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLRNAVNLAVLKLNEQGLL
DKLKNKWWYDKGECGSGGGDSKEKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSR
AEAKRMKVAKNAQNINPSSSQNSQNFATYKEGYNVYGIESVKI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50253650
NameBDBM50253650
Synonyms:CHEMBL462490 | [1,2,5]oxadiazolo[3,4-g]quinoxaline-6,7(5H,8H)-dione 1-oxide
TypeSmall organic molecule
Emp. Form.C8H4N4O4
Mol. Mass.220.1418
SMILES[O-][n+]1onc2cc3[nH]c(=O)c(=O)[nH]c3cc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a