Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCasein kinase I isoform alpha
LigandBDBM50094895
Substrate/Competitorn/a
Meas. Tech.ChEMBL_535969
IC50 4000±n/a nM
Citation Cozza, GGianoncelli, AMontopoli, MCaparrotta, LVenerando, AMeggio, FPinna, LAZagotto, GMoro, S Identification of novel protein kinase CK1 delta (CK1delta) inhibitors through structure-based virtual screening. Bioorg Med Chem Lett18:5672-5 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Casein kinase I isoform alpha
Name:Casein kinase I isoform alpha
Synonyms:CK1 | CKI-alpha | CSNK1A1 | Casein Kinase I | Casein kinase 1 alpha (CK1 alpha)
Type:Serine/threonine-protein kinase
Mol. Mass.:38936.59
Organism:Homo sapiens (Human)
Description:P48729
Residue:337
Sequence:
MASSSGSKAEFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYE
SKLYKILQGGVGIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQM
ISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKN
LTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKK
MSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTM
LKQKAAQQAASSSGQGQQAQTPTGKQTDKTKSNMKGF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50094895
NameBDBM50094895
Synonyms:1,4-diamino-9,10-anthraquinone | 1,4-diamino-anthraquinone | 1,4-diaminoanthracene-9,10-dione | CHEMBL86771
TypeSmall organic molecule
Emp. Form.C14H10N2O2
Mol. Mass.238.2414
SMILESNc1ccc(N)c2C(=O)c3ccccc3C(=O)c12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a