Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGag polyprotein
LigandBDBM50253469
Substrate/Competitorn/a
Meas. Tech.ChEMBL_536774
IC50 1400±n/a nM
Citation LaFrate, ALGunther, JRCarlson, KEKatzenellenbogen, JA Synthesis and biological evaluation of guanylhydrazone coactivator binding inhibitors for the estrogen receptor. Bioorg Med Chem16:10075-84 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Gag polyprotein
Name:Gag polyprotein
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:61664.68
Organism:Avian erythroblastosis virus (strain ES4)
Description:ChEMBL_536774
Residue:555
Sequence:
REEQVTSEQAKFWLGLGGGRVSPPGPECIEKPATERRIDKGEEMGETTVQRDAKMAPEKM
ATPKTVGTSCYQCGTATGCNCVTASAPPPPYVGSGLYPSLAGAGEQGQGGDTPRGAEQPR
AEPGHAGQAPGPALTDWARIREELASTGPPVVAMPVVIKTEGPAWTPLEPEDTRWLDGKH
KRKSSQCLVKSSMSGYIPSCLDKDEQCVVCGDKATGYHYRCITCEGCKSFFRRTIQKNLH
PTYSCTYDGCCVIDKITRNQCQLCRFKKCISVGMAMDLVLDDSKRVAKRKLIEENRERRR
KEEMIKSLQHRPSPSAEEWELIHVVTEAHRSTNAQGSHWKQRRKFLLEDIGQSPMASMLD
GDKVDLEAFSEFTKIITPAITRVVDFAKNLPMFSELPCEDQIILLKGCCMEIMSLRAAVR
YDPESETLTLSGEMAVKREQLKNGGLGVVSDAIFDLGKSLSAFNLDDTEVALLQAVLLMS
SDRTGLICVDKIEKCQESYLLAFEHYINYRKHNIPHFWSKLLMKVADLRMIGAYHASRFL
HMKVECPTELSPQEV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50253469
NameBDBM50253469
Synonyms:1-Chloro-3,4-dihydronaphthalene-2-carboxaldehyde guanylhydrazone | 2-[(1-chloro-3,4-dihydronaphthalen-2-yl)methylene]hydrazinecarboximidamide | CHEMBL448651
TypeSmall organic molecule
Emp. Form.C12H13ClN4
Mol. Mass.248.711
SMILES[#7]\[#6](-[#7])=[#7]\[#7]=[#6]-[#6]-1=[#6](Cl)-c2ccccc2-[#6]-[#6]-1 |w:5.5,c:6|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a