Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetC-X-C chemokine receptor type 4 (CXCR4)
LigandBDBM50247129
Substrate/Competitorn/a
Meas. Tech.ChEMBL_556955
IC50 2.1±n/a nM
Citation Thoma, GStreiff, MBKovarik, JGlickman, FWagner, TBeerli, CZerwes, HG Orally bioavailable isothioureas block function of the chemokine receptor CXCR4 in vitro and in vivo. J Med Chem51:7915-20 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
C-X-C chemokine receptor type 4 (CXCR4)
Name:C-X-C chemokine receptor type 4 (CXCR4)
Synonyms:C-X-C chemokine receptor type 4 | CD_antigen=CD184 | CXC-R4 | CXCR-4 | FB22 | Fusin | HM89 | LCR1 | LESTR | Leukocyte-derived seven transmembrane domain receptor | NPYRL | SDF-1 receptor | Stromal cell-derived factor 1 receptor
Type:Enzyme
Mol. Mass.:39754.61
Organism:Homo sapiens (Human)
Description:P61073
Residue:352
Sequence:
MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYSIIFLTGIVGNGLVI
LVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVANWYFGNFLCKAVHVIYTVNL
YSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWIPALLLTIPDFIFANVSEA
DDRYICDRFYPNDLWVVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSKGHQKRKALKT
TVILILAFFACWLPYYIGISIDSFILLEIIKQGCEFENTVHKWISITEALAFFHCCLNPI
LYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSSFHSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50247129
n/a
NameBDBM50247129
Synonyms:1,3-dicycloheptyl-2-((6,6-dimethyl-5,6-dihydroimidazo[2,1-b]thiazol-3-yl)methyl)isothiourea | CHEMBL518501
TypeSmall organic molecule
Emp. Form.C23H38N4S2
Mol. Mass.434.705
SMILESCC1(C)CN2C(CS\C(NC3CCCCCC3)=N/C3CCCCCC3)=CSC2=N1 |c:26,30|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: