Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetVoltage-gated potassium channel subunit Kv7.1
LigandBDBM50279433
Substrate/Competitorn/a
Meas. Tech.ChEMBL_545265
IC50 5400±n/a nM
Citation Du, LLi, MYang, QTang, YYou, QXia, L Molecular hybridization, synthesis, and biological evaluation of novel chroman I(Kr) and I(Ks) dual blockers. Bioorg Med Chem Lett19:1477-80 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Voltage-gated potassium channel subunit Kv7.1
Name:Voltage-gated potassium channel subunit Kv7.1
Synonyms:IKs producing slow voltage-gated potassium channel subunit alpha KvLQT1 | KQT-like 1 | Potassium voltage-gated channel subfamily KQT member 1
Type:PROTEIN
Mol. Mass.:74450.11
Organism:Cavia porcellus
Description:ChEMBL_88894
Residue:671
Sequence:
MAAASSPPRTERKRGGWGRLLGSRRGSASLAKKCPFSLELAEGGPAGGTLYAPVAPPGAL
SPGSPAPPASPAAPPAGLELGPRPPVSLDPRVSIYSARRPLLARTHIQGRVYNFLERPTG
WKCFVYHFAVFLIVLACLIFSVLSTIEQYAALATGTLFWMEIVLVVFFGTEYVVRLWSAG
CRSKYVGIWGRLRFARKPISIIDLIVVVASMVVLCVGSKGQVFATSAIRGIRFLQILRML
HVDRQGGTWRLLGSVVFIHRQELITTLYIGFLGLIFSSYFVYLAEKDAVNESGRVEFGSY
ADALWWGVVTVTTIGYGDKVPQTWVGKTIASCFSVFAISFFALPAGILGSGFALKVQQKQ
RQKHFNRQIPAAASLIQTAWRCYAAENPDSSTWKIYVRKPARSHTLLSPSPKPKKSAMVR
KKKFKPDKDNGVSPGEKMLTVPHITCDPPEERRPDHFSVDGYDSSVRKSPTLLEVSPTHF
MRTNSFAEDLDLEGETLLTPITHVSQLREHHRATIKVIRRMQYFVAKKKFQQARKPYDVR
DVIEQYSQGHLNLMVRIKELQRRLDQSIGKPSLFIPISEKSKDRGSNTIGARLNRVEDKV
TQLDQRLVVITDMLHQLLSLHQGGPHSGGGPQMVQPCSEDGSIHPELFLPSNSLPTYEQL
TVPQRGPDEAS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50279433
NameBDBM50279433
Synonyms:1-(2,3-dihydro-6-hydroxychromen-4-ylideneamino)-3-(4-(piperidin-1-yl)butyl)imidazolidine-2,4-dione | CHEMBL518885
TypeSmall organic molecule
Emp. Form.C21H28N4O4
Mol. Mass.400.4714
SMILESOc1cn(N=C2CCOc3ccc(O)cc23)c(=O)n1CCCCN1CCCCC1 |w:4.3|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a