Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLow molecular weight phosphotyrosine protein phosphatase (LMWPTP)
LigandBDBM50267100
Substrate/Competitorn/a
Meas. Tech.ChEMBL_563762
IC50 3700±n/a nM
Citation Ottanà, RMaccari, RCiurleo, RPaoli, PJacomelli, MManao, GCamici, GLaggner, CLanger, T 5-Arylidene-2-phenylimino-4-thiazolidinones as PTP1B and LMW-PTP inhibitors. Bioorg Med Chem17:1928-37 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Low molecular weight phosphotyrosine protein phosphatase (LMWPTP)
Name:Low molecular weight phosphotyrosine protein phosphatase (LMWPTP)
Synonyms:ACP1 | Adipocyte acid phosphatase | LMW-PTP | LMW-PTPase | LMWPTP | Low molecular weight cytosolic acid phosphatase | Low molecular weight phosphotyrosine protein phosphatase | Red cell acid phosphatase 1 | low molecular weight phosphotyrosine protein phosphatase isoform c
Type:n/a
Mol. Mass.:18042.81
Organism:Homo sapiens (Human)
Description:P24666
Residue:158
Sequence:
MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRG
QSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSY
DPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50267100
NameBDBM50267100
Synonyms:4-[(5-Naphthalen-2-ylmethylene-4-oxo-2-phenyliminothiazolidin-3-yl)methyl] benzoic acid | CHEMBL476666
TypeSmall organic molecule
Emp. Form.C28H20N2O3S
Mol. Mass.464.535
SMILESOC(=O)c1ccc(CN2\C(S\C(=C/c3ccc4ccccc4c3)C2=O)=N\c2ccccc2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a