Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLow molecular weight phosphotyrosine protein phosphatase (LMWPTP)
LigandBDBM50256796
Substrate/Competitorn/a
Meas. Tech.ChEMBL_562674
IC50 3000±n/a nM
Citation Forghieri, MLaggner, CPaoli, PLanger, TManao, GCamici, GBondioli, LPrati, FCostantino, L Synthesis, activity and molecular modeling of a new series of chromones as low molecular weight protein tyrosine phosphatase inhibitors. Bioorg Med Chem17:2658-72 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Low molecular weight phosphotyrosine protein phosphatase (LMWPTP)
Name:Low molecular weight phosphotyrosine protein phosphatase (LMWPTP)
Synonyms:ACP1 | Adipocyte acid phosphatase | LMW-PTP | LMW-PTPase | LMWPTP | Low molecular weight cytosolic acid phosphatase | Low molecular weight phosphotyrosine protein phosphatase | Red cell acid phosphatase 1 | low molecular weight phosphotyrosine protein phosphatase isoform c
Type:n/a
Mol. Mass.:18042.81
Organism:Homo sapiens (Human)
Description:P24666
Residue:158
Sequence:
MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRG
QSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSY
DPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50256796
NameBDBM50256796
Synonyms:6,7-Dihydroxy-2-(4'-hydroxyphenyl)-3-[(1,1'-biphenyl-4-yl)methyl]-4H-1-benzopyran-4-one | CHEMBL515146
TypeSmall organic molecule
Emp. Form.C28H20O5
Mol. Mass.436.4554
SMILESOc1ccc(cc1)-c1oc2cc(O)c(O)cc2c(=O)c1Cc1ccc(cc1)-c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a