Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine receptors; A1 & A2a
LigandBDBM50267577
Substrate/Competitorn/a
Meas. Tech.ChEMBL_562991
Ki 0.54±n/a nM
Citation Franchetti, PCappellacci, LVita, PPetrelli, RLavecchia, AKachler, SKlotz, KNMarabese, ILuongo, LMaione, SGrifantini, M N6-Cycloalkyl- and N6-bicycloalkyl-C5'(C2')-modified adenosine derivatives as high-affinity and selective agonists at the human A1 adenosine receptor with antinociceptive effects in mice. J Med Chem52:2393-406 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine receptors; A1 & A2a
Name:Adenosine receptors; A1 & A2a
Synonyms:A1 adenosine receptor (hA1) | A1AR | ADENOSINE A1 | ADORA1 | Adenosine A1 receptor (A1AR) | Adenosine A1-receptor | Adenosine receptor A1 (A1) | Adenosine receptor A1 (hA1) | Adenosine transporter (AdT)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:36520.92
Organism:Homo sapiens (human)
Description:Expressed in CHO cells
Residue:326
Sequence:
MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA
LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKMVVT
PRRAAVAIAGCWILSFVVGLTPMFGWNNLSAVERAWAANGSMGEPVIKCEFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL
FLFALSWLPLHILNCITLFCPSCHKPSILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFL
KIWNDHFRCQPAPPIDEDLPEERPDD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50267577
n/a
NameBDBM50267577
Synonyms:CHEMBL489640 | N6-((+/-)-endo-norborn-2-yl)adenosine
TypeSmall organic molecule
Emp. Form.C17H23N5O4
Mol. Mass.361.3956
SMILESOC[C@H]1O[C@H]([C@H](O)[C@@H]1O)n1cnc2c(NC3CC4CCC3C4)ncnc12 |r,TLB:14:15:19.18:21|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: