Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPhosphodiesterase 1C (PDE1C)
LigandBDBM50259015
Substrate/Competitorn/a
Meas. Tech.ChEMBL_500710
IC50 4±n/a nM
Citation Deninno, MPAndrews, MBell, ASChen, YEller-Zarbo, CEshelby, NEtienne, JBMoore, DEPalmer, MJVisser, MSYu, LJZavadoski, WJMichael Gibbs, E The discovery of potent, selective, and orally bioavailable PDE9 inhibitors as potential hypoglycemic agents. Bioorg Med Chem Lett19:2537-41 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Phosphodiesterase 1C (PDE1C)
Name:Phosphodiesterase 1C (PDE1C)
Synonyms:Phosphodiesterase 1 | Phosphodiesterase 1C | Phosphodiesterase, PDE1/PDE5
Type:Enzyme
Mol. Mass.:80778.58
Organism:Homo sapiens (Human)
Description:Q14123
Residue:709
Sequence:
MESPTKEIEEFESNSLKYLQPEQIEKIWLRLRGLRKYKKTSQRLRSLVKQLERGEASVVD
LKKNLEYAATVLESVYIDETRRLLDTEDELSDIQSDAVPSEVRDWLASTFTRQMGMMLRR
SDEKPRFKSIVHAVQAGIFVERMYRRTSNMVGLSYPPAVIEALKDVDKWSFDVFSLNEAS
GDHALKFIFYELLTRYDLISRFKIPISALVSFVEALEVGYSKHKNPYHNLMHAADVTQTV
HYLLYKTGVANWLTELEIFAIIFSAAIHDYEHTGTTNNFHIQTRSDPAILYNDRSVLENH
HLSAAYRLLQDDEEMNILINLSKDDWREFRTLVIEMVMATDMSCHFQQIKAMKTALQQPE
AIEKPKALSLMLHTADISHPAKAWDLHHRWTMSLLEEFFRQGDREAELGLPFSPLCDRKS
TMVAQSQVGFIDFIVEPTFTVLTDMTEKIVSPLIDETSQTGGTGQRRSSLNSISSSDAKR
SGVKTSGSEGSAPINNSVISVDYKSFKATWTEVVHINRERWRAKVPKEEKAKKEAEEKAR
LAAEEQQKEMEAKSQAEEGASGKAEKKTSGETKNQVNGTRANKSDNPRGKNSKAEKSSGE
QQQNGDFKDGKNKTDKKDHSNIGNDSKKTDGTKQRSHGSPAPSTSSTCRLTLPVIKPPLR
HFKRPAYASSSYAPSVSKKTDEHPARYKMLDQRIKMKKIQNISHNWNRK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50259015
NameBDBM50259015
Synonyms:5-(3-chlorobenzyl)-3-isopropyl-1H-pyrazolo[4,3-d]pyrimidin-7(6H)-one | CHEMBL512790
TypeSmall organic molecule
Emp. Form.C15H15ClN4O
Mol. Mass.302.759
SMILESCC(C)c1[nH]nc2c1nc(Cc1cccc(Cl)c1)[nH]c2=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a