Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenylate kinase isoenzyme 1
LigandBDBM50277972
Substrate/Competitorn/a
Meas. Tech.ChEMBL_502057
IC50>500000±n/a nM
Citation Dang, QBrown, BSLiu, YRydzewski, RMRobinson, EDvan Poelje, PDReddy, MRErion, MD Fructose-1,6-bisphosphatase inhibitors. 1. Purine phosphonic acids as novel AMP mimics. J Med Chem52:2880-98 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenylate kinase isoenzyme 1
Name:Adenylate kinase isoenzyme 1
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:21643.19
Organism:Oryctolagus cuniculus
Description:ChEMBL_502057
Residue:194
Sequence:
MEEKLKKAKIIFVVGGPGSGKGTQCEKIVHKYGYTHLSTGDLLRAEVSSGSARGKKLSEI
MEKGQLVPLETVLDMLRDAMVAKADTSKGFLIDGYPRQVQQGEEFERRIAQPTLLLYVDA
GPETMQKRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVD
NVFSQVCTHLDALK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50277972
NameBDBM50277972
Synonyms:CHEMBL519503 | [5-(6-Amino-9-phenethyl-9H-purin-8-yl)-furan-2-yl]-phosphonic Acid
TypeSmall organic molecule
Emp. Form.C17H16N5O4P
Mol. Mass.385.3138
SMILESNc1ncnc2n(CCc3ccccc3)c(nc12)-c1ccc(o1)P(O)(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a