BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarboxypeptidase A1
LigandBDBM50279953
Substrate/Competitorn/a
Meas. Tech.ChEBML_45616
Ki 170±n/a nM
Citation Kim, DHShin, YSKim, KB The structural feature of S1′ subsite of carboxypeptidase A Bioorg Med Chem Lett1:317-322 (1991)    Article
More Info.:Get all data from this article,  Assay Method
 
Carboxypeptidase A1
Name:Carboxypeptidase A1
Synonyms:CPA1 | Carboxypeptidase A | Carboxypeptidase A (CPA) | Carboxypeptidase A1 precursor
Type:Enzyme
Mol. Mass.:47073.90
Organism:Bos taurus (bovine)
Description:From Sigma-Aldrich Co.
Residue:419
Sequence:
MQGLLILSVLLGAALGKEDFVGHQVLRITAADEAEVQTVKELEDLEHLQLDFWRGPGQPG
SPIDVRVPFPSLQAVKVFLEAHGIRYRIMIEDVQSLLDEEQEQMFASQSRARSTNTFNYA
TYHTLDEIYDFMDLLVAEHPQLVSKLQIGRSYEGRPIYVLKFSTGGSNRPAIWIDLGIHS
REWITQATGVWFAKKFTEDYGQDPSFTAILDSMDIFLEIVTNPDGFAFTHSQNRLWRKTR
SVTSSSLCVGVDANRNWDAGFGKAGASSSPCSETYHGKYANSEVEVKSIVDFVKDHGNFK
AFLSIHSYSQLLLYPYGYTTQSIPDKTELNQVAKSAVEALKSLYGTSYKYGSIITTIYQA
SGGSIDWSYNQGIKYSFTFELRDTGRYGFLLPASQIIPTAQETWLGVLTIMEHTLNNLY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50279953
NameBDBM50279953
Synonyms:2-Mercaptomethyl-3-m-tolyl-propionic acid | CHEMBL322812
TypeSmall organic molecule
Emp. Form.C11H14O2S
Mol. Mass.210.293
SMILESCc1cccc(CC(CS)C(O)=O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a