BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target3-dehydroquinate synthase
LigandBDBM50280172
Substrate/Competitorn/a
Meas. Tech.ChEMBL_356
Ki 5.4±n/a nM
Citation Montchamp, JLPiehler, LTTolbert, TJFront, JW The basis for slowly reversible inhibition of dehydroquinate synthase: a case of mistaken identity? Bioorg Med Chem Lett2:1349-1352 (1992)    Article
More Info.:Get all data from this article,  Assay Method
 
3-dehydroquinate synthase
Name:3-dehydroquinate synthase
Synonyms:n/a
Type:Enzyme
Mol. Mass.:38878.02
Organism:Escherichia coli (strain K12)
Description:P07639
Residue:362
Sequence:
MERIVVTLGERSYPITIASGLFNEPASFLPLKSGEQVMLVTNETLAPLYLDKVRGVLEQA
GVNVDSVILPDGEQYKSLAVLDTVFTALLQKPHGRDTTLVALGGGVVGDLTGFAAASYQR
GVRFIQVPTTLLSQVDSSVGGKTAVNHPLGKNMIGAFYQPASVVVDLDCLKTLPPRELAS
GLAEVIKYGIILDGAFFNWLEENLDALLRLDGPAMAYCIRRCCELKAEVVAADERETGLR
ALLNLGHTFGHAIEAEMGYGNWLHGEAVAAGMVMAARTSERLGQFSSAETQRIITLLKRA
GLPVNGPREMSAQAYLPHMLRDKKVLAGEMRLILPLAIGKSEVRSGVSHELVLNAIADCQ
SA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50280172
NameBDBM50280172
Synonyms:1,3,4-Trihydroxy-5-phosphonomethyl-cyclohexanecarboxylic acid | CHEMBL281425
TypeSmall organic molecule
Emp. Form.C8H15O8P
Mol. Mass.270.1737
SMILESOC1CC(O)(CC(CP(O)(O)=O)C1O)C(O)=O
Structure
n/a