BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLTB4R
LigandBDBM50280291
Substrate/Competitorn/a
Meas. Tech.ChEMBL_99493
Ki 3.5±n/a nM
Citation Sofia, MJSaussyJr., DLJackson, WTMarder, PSilbaugh, SAFroelich, LLCockerham, SLStengel, PW Ortho-alkoxyphenol leukotriene B4 receptor antagonists: effect of a chroman carboxylic acid. Bioorg Med Chem Lett2:1675-1680 (1992)    Article
More Info.:Get all data from this article,  Assay Method
 
LTB4R
Name:LTB4R
Synonyms:Chemoattractant receptor-like 1 | G-protein coupled receptor 16 | LTB4-R 1 | Leukotriene B4 R1 | Leukotriene B4 receptor | Leukotriene B4 receptor 1 | P2Y purinoceptor 7 | P2Y7
Type:Enzyme Catalytic Domain
Mol. Mass.:37582.68
Organism:HUMAN
Description:Leukotriene B4 R1 LTB4R HUMAN::Q15722
Residue:352
Sequence:
MNTTSSAAPPSLGVEFISLLAIILLSVALAVGLPGNSFVVWSILKRMQKRSVTALMVLNL
ALADLAVLLTAPFFLHFLAQGTWSFGLAGCRLCHYVCGVSMYASVLLITAMSLDRSLAVA
RPFVSQKLRTKAMARRVLAGIWVLSFLLATPVLAYRTVVPWKTNMSLCFPRYPSEGHRAF
HLIFEAVTGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILTFAAFWLPYHVV
NLAEAGRALAGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGF
VAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNELN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50280291
NameBDBM50280291
Synonyms:7-[3-(4-Ethoxy-2-ethyl-5-hydroxy-phenoxy)-propoxy]-8-propyl-chroman-2-carboxylic acid | CHEMBL416277
TypeSmall organic molecule
Emp. Form.C26H34O7
Mol. Mass.458.544
SMILESCCCc1c(OCCCOc2cc(O)c(OCC)cc2CC)ccc2CCC(Oc12)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a