BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLTB4R
LigandBDBM50284122
Substrate/Competitorn/a
Meas. Tech.ChEBML_99648
IC50 0.150000±n/a nM
Citation Djuric', SWDocter, SHYu, SSTsai, BSAnglin, CPGaginella, TSKachur, JFKeith, RHMaziasz, TJVillani-Price, DRao, TSWalsh, REWidomski, DLFretland, DJ Synthesis and pharmacological activity of SC-53228, a leukotriene B4 receptor antagonist with high intrinsic potency and selectivity Bioorg Med Chem Lett4:811-816 (1994)    Article
More Info.:Get all data from this article,  Assay Method
 
LTB4R
Name:Leukotriene B4 receptor
Synonyms:Chemoattractant receptor-like 1 | G-protein coupled receptor 16 | LTB4-R 1 | Leukotriene B4 R1 | Leukotriene B4 receptor | Leukotriene B4 receptor 1 | P2Y purinoceptor 7 | P2Y7
Type:Enzyme Catalytic Domain
Mol. Mass.:37582.68
Organism:Homo sapiens (Human)
Description:Leukotriene B4 R1 LTB4R HUMAN::Q15722
Residue:352
Sequence:
MNTTSSAAPPSLGVEFISLLAIILLSVALAVGLPGNSFVVWSILKRMQKRSVTALMVLNL
ALADLAVLLTAPFFLHFLAQGTWSFGLAGCRLCHYVCGVSMYASVLLITAMSLDRSLAVA
RPFVSQKLRTKAMARRVLAGIWVLSFLLATPVLAYRTVVPWKTNMSLCFPRYPSEGHRAF
HLIFEAVTGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILTFAAFWLPYHVV
NLAEAGRALAGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGF
VAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNELN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50284122
NameBDBM50284122
Synonyms:7-[3-(4-Dimethylcarbamoyl-3-methoxy-2-propyl-phenoxy)-propoxy]-8-propyl-chroman-2-carboxylic acid | CHEMBL167350 | SC-52569
TypeSmall organic molecule
Emp. Form.C29H39NO7
Mol. Mass.513.6225
SMILESCCCc1c(OCCCOc2ccc3CCC(Oc3c2CCC)C(O)=O)ccc(C(=O)N(C)C)c1OC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a